Human OTX2

Rabbit

Human, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity)

Zebrafish (at least 90% immunogen sequence identity)

IgG Polyclonal

Unconjugated

Immunoaffinity purified

Unmodified

Synthetic peptide from the C-Terminus of human Orthodenticle homeobox 2 (DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL). Percent identity by BLAST analysis: Human, Mouse, Rat, Ferret, Sheep, Cat, Bovine, Hamster, Elephant, Rabbit, Horse, Pig, Opossum, Chicken, Xenopus, Dog (100%); Trout, Medaka, Pufferfish (97%); Lizard, Newt, Zebrafish (94%); Stickleback (90%).

aa266-296

Human OTX2

• Western blot (0.5 - 1 µg/ml)

Orthodenticle homeobox 2 is also known as CPHD6 or MCOPS5. The OTX2 gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. Otx2 acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). Otx2 is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.

Reconstitute in sterile distilled water.

Prior to reconstitution, 4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: P32243 NCBI: NM_021728 NP_068374.1