LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
NUDT2 Antibody LS‑C346123
NUDT2 antibody LS-C346123 is an unconjugated rabbit polyclonal antibody to NUDT2 from human, mouse and rat. Validated for IF, IHC and WB.
Catalog
Size
Price
LS-C346123-50
50 µl
$235
LS-C346123-100
100 µl
$315
LS-C346123-200
200 µl
$425
Description
NUDT2 antibody LS-C346123 is an unconjugated rabbit polyclonal antibody to NUDT2 from human, mouse and rat. Validated for IF, IHC and WB.
Target
Human NUDT2
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
NUDT2 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human NUDT2 (NP_001152.1). MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Specificity
Human NUDT2
Usage
The predicted MW is 16kDa, while the observed MW by Western blot was 17kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About NUDT2
P50583 NM_001161 NP_001152.1

Popular NUDT2 Products

Antibody
Species: Human, Mouse, Rat
Applications: IHC, Immunofluorescence, Western blot
Immunofluorescent analysis of NUDT2 staining in HeLa cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with the primary antibody in 3% BSA-PBS and incubated overnight at 4 deg C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight 594-conjugated secondary antibody (red) in PBS at room temperature in the dark.
Species: Human, Mouse, Rat
Applications: ICC, Immunofluorescence, Western blot
Antibody
Species: Human
Applications: IHC, Western blot, ELISA
Immunohistochemistry of paraffin-embedded human tonsil tissue at dilution 1:100
Species: Human
Applications: IHC, IHC - Paraffin, ELISA

Publications (0)


Customer Reviews (0)


Images

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 12/11/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy