Products
Services
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C349159-20 20 µl $215 
LS-C349159-50 50 µl (3.34 mg/ml) $235 
LS-C349159-100 100 µl $315 
LS-C349159-200 200 µl $425 
NR2E1 / TLX Antibody - Immunofluorescence analysis of A549 cells.
NR2E1 / TLX Antibody - Western blot analysis of extracts of various cell lines.
NR2E1 / TLX Antibody - Immunofluorescence analysis of A549 cells.
NR2E1 / TLX Antibody - Western blot analysis of extracts of various cell lines.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human NR2E1 / TLX Antibody (IF, WB) LS‑C349159

Polyclonal Rabbit anti‑Human NR2E1 / TLX Antibody (IF, WB) LS‑C349159

Antibody:
Rabbit Polyclonal to Human NR2E1 / TLX
Application:
IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$215 
LS-C349159-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
Rabbit Polyclonal to Human NR2E1 / TLX
Application:
IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
TLX antibody LS-C349159 is an unconjugated rabbit polyclonal antibody to TLX (NR2E1) from human. It is reactive with human, mouse and rat. Validated for IF and WB.
Target
Human NR2E1 / TLX
Synonyms
NR2E1 | HTll | Tailless homolog | Tailless | TLX | TLL | Nuclear receptor TLX | Protein tailless homolog | Tailes-related receptor | XTLL
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Immunofluorescence
  • Western blot (1:500 - 1:2000)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 106-385 of human NR2E1 (NP_003260.1). YFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI
Specificity
Human NR2E1 / TLX
Usage
The predicted MW is 42kDa/46kDa, while the observed MW by Western blot was 43kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NR2E1 / TLX
Q9Y466 NM_003269 NP_003260.1

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 7/10/2020