Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334745-20 20 µl $263 
LS-C334745-50 50 µl $289 
LS-C334745-100 100 µl $343 
LS-C334745-200 200 µl $439 
NGB / Neuroglobin Antibody - Immunofluorescence analysis of U2OS cells.
NGB / Neuroglobin Antibody - Western blot analysis of extracts of various cell lines.
NGB / Neuroglobin Antibody - Immunofluorescence analysis of U2OS cells.
NGB / Neuroglobin Antibody - Western blot analysis of extracts of various cell lines.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human NGB / Neuroglobin Antibody (IF, WB) LS‑C334745

Polyclonal Rabbit anti‑Human NGB / Neuroglobin Antibody (IF, WB) LS‑C334745

Antibody:
NGB / Neuroglobin Rabbit anti-Human Polyclonal Antibody
Application:
IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C334745-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
NGB / Neuroglobin Rabbit anti-Human Polyclonal Antibody
Application:
IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
Neuroglobin antibody LS-C334745 is an unconjugated rabbit polyclonal antibody to Neuroglobin (NGB) from human. It is reactive with human, mouse and rat. Validated for IF and WB.
Target
Human NGB / Neuroglobin
Synonyms
NGB | Neuroglobin
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-151 of human NGB (NP_067080.1). MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Specificity
Human NGB / Neuroglobin
Applications
  • Immunofluorescence (1:10 - 1:100)
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 16kDa, while the observed MW by Western blot was 17kDa/35kDa/70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NGB / Neuroglobin
Q9NPG2 NM_021257 NP_067080.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/9/2022