Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > NFIA / Nuclear Factor 1 > LS-C661861
 
Print Page  
Catalog Number Size Price
LS-C661861-10 10 µg $318 
LS-C661861-100 100 µg $470 
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Western blot - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Western blot - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of U20S cells using anti-NFIA antibody. Overlay histogram showing U20S cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of SiHa cells using anti-NFIA antibody. Overlay histogram showing SiHa cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control. Flow Cytometry analysis of U20S cells using anti-NFIA antibody. Overlay histogram showing U20S cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of K562 cells using anti-NFIA antibody. Overlay histogram showing K562 cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Western blot - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Western blot - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of U20S cells using anti-NFIA antibody. Overlay histogram showing U20S cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of SiHa cells using anti-NFIA antibody. Overlay histogram showing SiHa cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control. Flow Cytometry analysis of U20S cells using anti-NFIA antibody. Overlay histogram showing U20S cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of K562 cells using anti-NFIA antibody. Overlay histogram showing K562 cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 8
2 of 8
3 of 8
4 of 8
5 of 8
6 of 8
7 of 8
8 of 8

Polyclonal Rabbit anti‑Human NFIA / Nuclear Factor 1 Antibody (IHC, WB) LS‑C661861

Polyclonal Rabbit anti‑Human NFIA / Nuclear Factor 1 Antibody (IHC, WB) LS‑C661861

Submit Review LSBio Guarantee
Antibody:
NFIA / Nuclear Factor 1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C661861-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
NFIA / Nuclear Factor 1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
Nuclear Factor 1 antibody LS-C661861 is an unconjugated rabbit polyclonal antibody to human Nuclear Factor 1 (NFIA). Validated for Flow, ICC, IHC and WB.
Target
Human NFIA / Nuclear Factor 1
Synonyms
NFIA | CTF | NF1-A | NF-I/A | NFI-L | Nuclear Factor 1 | TGGCA-binding protein | NFI-A | Nuclear factor 1 A-type | KIAA1439 | Nuclear factor 1/A | Nuclear factor I/A
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224 aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSG VFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Applications
  • IHC
  • IHC - Paraffin
  • ICC
  • Western blot
  • Flow Cytometry
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NFIA / Nuclear Factor 1
Q12857 NM_005595 NP_005586.1

Publications (0)

Submit a Publication for LS-C661861

Customer Reviews (0)

Submit a review for LS-C661861

Featured Products

NFIA / Nuclear Factor 1 Antibody - Anti-NFIA / Nuclear Factor 1 antibody IHC staining of human skin, epidermis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
IHC‑plus™ NFIA / Nuclear Factor 1 Antibody (aa470‑498) LS‑B9077
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
NFIA / Nuclear Factor 1 Antibody - Immunohistochemical analysis of NFIA staining in human breast cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
NFIA / Nuclear Factor 1 Antibody (N‑Terminus) LS‑C354251
Species: Human, Mouse, Rat, Bovine, Pig, Chicken, Zebrafish
Applications: IHC, IHC - Paraffin, Western blot
NFIA / Nuclear Factor 1 Antibody - Anti-NFIA antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
NFIA / Nuclear Factor 1 Antibody (aa348‑397) LS‑B1549
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
NFIA / Nuclear Factor 1 Antibody - Anti-NFIA antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
NFIA / Nuclear Factor 1 Antibody (aa348‑397, Biotin) LS‑C428417
Species: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Rabbit, Chicken, Xenopus
Applications: IHC, IHC - Paraffin, Western blot
IgE ELISA Kit
Rat IgE (Sandwich ELISA) ELISA Kit - LS-F36501
Reactivity: Rat
Range: 0.156-10 ng/ml
AKAP11 / KIAA0629 Antibody - Western Blot; Sample: Recombinant AKAP11, Human.
AKAP11 / KIAA0629 Antibody (aa159‑258) LS‑C374339
Species: Human
Applications: Western blot
See all NFIA / Nuclear Factor 1 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/19/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com