Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C748479-50 50 µl $235 
LS-C748479-100 100 µl $295 
LS-C748479-200 200 µl $385 

NAT8B Antibody LS‑C748479

NAT8B Antibody LS‑C748479

Rabbit Polyclonal to Human NAT8B
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human NAT8B
Unconjugated, Unmodified


NAT8B antibody LS-C748479 is an unconjugated rabbit polyclonal antibody to human NAT8B. Validated for IF.
Human NAT8B
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Immunofluorescence (1:50 - 1:200)
Recombinant fusion protein containing a sequence corresponding to amino acids 75-165 of human NAT8B (NP_057431.2). WFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFA
The predicted MW is 25kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NAT8B
Q9UHF3 NM_016347 NP_057431.2

Publications (0)

Reviews (0)

Featured Products

NAT8B Antibody - Immunohistochemistry of paraffin-embedded mouse heart.
Species: Human, Mouse, Rat
Applications: IHC, Immunofluorescence, Western blot
Species: Human
Applications: IHC, Immunofluorescence, Western blot
Species: Human, Mouse, Rat
Applications: IHC, Western blot
Species: Human
Applications: Immunofluorescence

Requested From: United States
Date Requested: 10/16/2019