LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

NAMPT / Visfatin Antibody LS-C330875

Immunohistochemistry of paraffin-embedded rat ovary using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human colon carcinoma using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human tonsil using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat spleen using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse spleen using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human ovary cancer using NAMPT antibody.
Immunohistochemistry of paraffin-embedded rat liver using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human liver cancer using NAMPT antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded rat spleen using NAMPT antibody at dilution of 1:200 (200x lens).
Immunofluorescence analysis of HeLa cells using NAMPT antibody.
Western blot analysis of extracts of various cell lines, using NAMPT antibody.
Western blot analysis of extracts of various cell lines, using NAMPT antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Immunohistochemistry of paraffin-embedded rat ovary using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human colon carcinoma using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human tonsil using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat spleen using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse spleen using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human ovary cancer using NAMPT antibody.
Immunohistochemistry of paraffin-embedded rat liver using NAMPT antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human liver cancer using NAMPT antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded rat spleen using NAMPT antibody at dilution of 1:200 (200x lens).
Immunofluorescence analysis of HeLa cells using NAMPT antibody.
Western blot analysis of extracts of various cell lines, using NAMPT antibody.
Western blot analysis of extracts of various cell lines, using NAMPT antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
1 of 12
2 of 12
3 of 12
4 of 12
5 of 12
6 of 12
7 of 12
8 of 12
9 of 12
10 of 12
11 of 12
12 of 12

NAMPT / Visfatin Antibody LS-C330875

Antibody:
Rabbit Polyclonal to Human NAMPT / Visfatin
Application:
IHC, IF, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C330875-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human NAMPT / Visfatin
Application:
IHC, IF, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
Visfatin antibody LS-C330875 is an unconjugated rabbit polyclonal antibody to Visfatin (NAMPT) from human and mouse. Validated for IF, IHC and WB.

Target
Human NAMPT / Visfatin
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human NAMPT (NP_005737.1). MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDS
Specificity
Human NAMPT / Visfatin
Usage
The predicted MW is 55kDa, while the observed MW by Western blot was 56kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NAMPT / Visfatin
P43490 NM_005746 NP_005737.1

Publications (0)

Reviews (0)

Featured Products


Requested From: United States
Date Requested: 6/18/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy