Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C334718-20 20 µl $263 
LS-C334718-50 50 µl $301 
LS-C334718-100 100 µl $359 
LS-C334718-200 200 µl $473 
MYOT / Myotilin Antibody - Immunohistochemistry of paraffin-embedded mouse heart tissue.
MYOT / Myotilin Antibody - Immunofluorescence analysis of U2OS cells.
MYOT / Myotilin Antibody - Western blot analysis of extracts of various cell lines.
MYOT / Myotilin Antibody - Immunohistochemistry of paraffin-embedded mouse heart tissue.
MYOT / Myotilin Antibody - Immunofluorescence analysis of U2OS cells.
MYOT / Myotilin Antibody - Western blot analysis of extracts of various cell lines.
1 of 3
2 of 3
3 of 3

Polyclonal Rabbit anti‑Human MYOT / Myotilin Antibody (IHC, IF, WB) LS‑C334718

Polyclonal Rabbit anti‑Human MYOT / Myotilin Antibody (IHC, IF, WB) LS‑C334718

MYOT / Myotilin Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


MYOT / Myotilin Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


Myotilin antibody LS-C334718 is an unconjugated rabbit polyclonal antibody to Myotilin (MYOT) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Human MYOT / Myotilin
MYOT | 57 kDa cytoskeletal protein | LGMD1 | LGMD1A | TTID | Myotilin
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 259-314 of human MYOT (NP_001129412.1). RPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL
Human MYOT / Myotilin
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:10 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 35kDa/55kDa, while the observed MW by Western blot was 55kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About MYOT / Myotilin
Q9UBF9 NM_006790 NP_006781.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 11/28/2022