LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
MRPS27 Antibody LS‑C747064
MRPS27 antibody LS-C747064 is an unconjugated rabbit polyclonal antibody to MRPS27 from human, mouse and rat. Validated for WB.
Catalog
Size
Price
LS-C747064-50
50 µl
$235

Popular MRPS27 Products

IHC of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-MRPS27 mouse monoclonal antibody.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Flow Cytometry
IHC of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-MRPS27 mouse monoclonal antibody.
Species: Human, Monkey
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
IHC of paraffin-embedded Human colon tissue using anti-MRPS27 mouse monoclonal antibody.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
IHC of paraffin-embedded Carcinoma of Human prostate tissue using anti-MRPS27 mouse monoclonal antibody.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
IHC of paraffin-embedded Adenocarcinoma of Human colon tissue using anti-MRPS27 mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min).
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry

Product Description

MRPS27 antibody LS-C747064 is an unconjugated rabbit polyclonal antibody to MRPS27 from human, mouse and rat. Validated for WB.

Specifications

Target
Human MRPS27
Synonyms
MRPS27, KIAA0264, MRP-S27, S27mt
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
MRPS27 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 255-414 of human MRPS27 (NP_055899.2). YLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA
Usage
The predicted MW is 47kDa/49kDa, while the observed MW by Western blot was 48kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About MRPS27
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Q92552 D87453 Q92552


Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines, using MRPS27 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.
Western blot analysis of extracts of various cell lines, using MRPS27 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.

Western blot

Western blot analysis of extracts of various cell lines, using MRPS27 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.
Western blot analysis of extracts of various cell lines, using MRPS27 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.

Western blot

Western blot analysis of extracts of various cell lines, using MRPS27 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.
Western blot analysis of extracts of various cell lines, using MRPS27 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.

Western blot

Western blot analysis of extracts of various cell lines, using MRPS27 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.
Western blot analysis of extracts of various cell lines, using MRPS27 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.

Requested From: United States
Date Requested: 11/15/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy