LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
MRGX1 / MRGPRX1 Antibody LS‑C748205
MRGPRX1 antibody LS-C748205 is an unconjugated rabbit polyclonal antibody to MRGPRX1 (MRGX1) from human, mouse and rat. Validated for WB.
Catalog
Size
Price
LS-C748205-50
50 µl
$235
Description
MRGPRX1 antibody LS-C748205 is an unconjugated rabbit polyclonal antibody to MRGPRX1 (MRGX1) from human, mouse and rat. Validated for WB.
Target
Human MRGX1 / MRGPRX1
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
MRGX1 / MRGPRX1 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 263-322 of human MRGPRX1 (NP_671732.3). LNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ
Usage
The predicted MW is 36kDa, while the observed MW by Western blot was 36kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About MRGX1 / MRGPRX1
Q96LB2 NM_147199 NP_671732.3

Popular MRGX1 / MRGPRX1 Products

MRGX1 / MRGPRX1 antibody Western Blot of Fetal Small Intestine.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: Western blot
Anti-MRGX1 / MRGPRX1 antibody IHC of human Ovary, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey
Applications: IHC, IHC - Paraffin, ICC
Antibody
Species: Rat
Applications: IHC, IHC - Paraffin, Western blot
Antibody
Species: Rat
Applications: IHC, IHC - Paraffin, Western blot
 This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Rat
Applications: IHC, IHC - Paraffin, Western blot

Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines, using MRGPRX1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using MRGPRX1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Western blot

Western blot analysis of extracts of various cell lines, using MRGPRX1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using MRGPRX1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Western blot

Western blot analysis of extracts of various cell lines, using MRGPRX1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using MRGPRX1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Western blot

Western blot analysis of extracts of various cell lines, using MRGPRX1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using MRGPRX1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Requested From: United States
Date Requested: 12/13/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy