Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

MLXIPL / CHREBP Antibody LS‑C409190

Catalog Number Size Price
LS-C409190-50 50 µl $235 
LS-C409190-100 100 µl $295 
LS-C409190-200 200 µl $385 
Western blot analysis of extracts of various cells.

MLXIPL / CHREBP Antibody LS‑C409190

Antibody:
Rabbit Polyclonal to Human MLXIPL / CHREBP
Application:
WB, IP
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C409190-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human MLXIPL / CHREBP
Application:
WB, IP
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CHREBP antibody LS-C409190 is an unconjugated rabbit polyclonal antibody to CHREBP (MLXIPL ) from human, mouse and rat. Validated for IP and WB.
Target
Human MLXIPL / CHREBP
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:10 - 1:100)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 17-175 of human MLXIPL (NP_116569.1). VAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIE
Specificity
Human MLXIPL / CHREBP
Usage
The predicted MW is 62kDa/78kDa/90kDa/92kDa/93kDa, while the observed MW by Western blot was 93kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About MLXIPL / CHREBP
Q9NP71 AF056184 AAD28084.1

Publications (0)

Reviews (0)

Featured Products

MLXIPL / CHREBP antibody ARP39736_T100-AAK20939-MLXIPL (MLX interacting protein-like) Antibody IHC of formalin-fixed, paraffin-embedded human Kidney. Positive label: Epithelial cells of renal tubule indicated with arrows. Antibody concentration 4-8 ug/ml. Magnification 400X.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Bovine, Guinea pig, Pig
Applications: IHC, IHC - Paraffin, Western blot
Product
Species: Human
Applications: Immunofluorescence
Anti-MLXIPL / CHREBP antibody IHC of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot, Immunoprecipitation, Chromatin Immunoprecipitation
MLXIPL Antibody immunohistochemistry of formalin-fixed and paraffin-embedded human liver tissue followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Immunofluorescence of HeLa cells using MLXIPL mouse monoclonal antibody (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Species: Human
Applications: Immunofluorescence, Western blot, ELISA
TREM2 antibody Western blot of Fetal human Muscle lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Rat, Bovine
Applications: Western blot

Requested From: United States
Date Requested: 9/19/2019