Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

LRP6 Antibody for IHC, WB/Western LS-C748380

LRP6 antibody LS-C748380 is an unconjugated rabbit polyclonal antibody to LRP6 from human, mouse and rat. Validated for IHC and WB.
50 µl
LRP6 antibody LS-C748380 is an unconjugated rabbit polyclonal antibody to LRP6 from human, mouse and rat. Validated for IHC and WB.
Human LRP6
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
LRP6 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human LRP6 (NP_002327.2). APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSG
The predicted MW is 180kDa, while the observed MW by Western blot was 170kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About LRP6
O75581 NM_002336 NP_002327.2

Popular LRP6 Products

Anti-LRP6 antibody IHC of human hepatocytes and bile duct. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Monkey, Rat, Dog, Hamster, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Peptide Enzyme-Linked Immunosorbent Assay
Sample (30 ug of whole cell lysate). A: Hep G2. 5% SDS PAGE. LRP6 antibody diluted at 1:500.
Species: Human
Applications: Western blot
Formalin-fixed and paraffin-embedded human breast carcinoma tissue reacted with LRP6 Antibody (C-term T1546), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Species: Human, Mouse
Applications: Western blot, Immunoprecipitation

Publications (0)

Customer Reviews (0)



Immunohistochemistry of paraffin-embedded human gastric cancer using LRP6 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human gastric cancer using LRP6 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded rat heart using LRP6 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat heart using LRP6 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of mouse liver, using LRP6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
Western blot analysis of extracts of mouse liver, using LRP6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.


Immunohistochemistry of paraffin-embedded human gastric cancer using LRP6 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human gastric cancer using LRP6 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded rat heart using LRP6 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat heart using LRP6 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of mouse liver, using LRP6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
Western blot analysis of extracts of mouse liver, using LRP6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.


Immunohistochemistry of paraffin-embedded human gastric cancer using LRP6 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human gastric cancer using LRP6 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded rat heart using LRP6 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat heart using LRP6 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of mouse liver, using LRP6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
Western blot analysis of extracts of mouse liver, using LRP6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.


Immunohistochemistry of paraffin-embedded human gastric cancer using LRP6 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human gastric cancer using LRP6 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded rat heart using LRP6 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat heart using LRP6 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of mouse liver, using LRP6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
Western blot analysis of extracts of mouse liver, using LRP6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.

Requested From: United States
Date Requested: 1/18/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy