Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
LRP6 Antibody LS‑C750044
LRP6 antibody LS-C750044 is an unconjugated rabbit polyclonal antibody to human LRP6. Validated for IF.
50 µl
LRP6 antibody LS-C750044 is an unconjugated rabbit polyclonal antibody to human LRP6. Validated for IF.
Human LRP6
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Immunofluorescence (1:50 - 1:200)
LRP6 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human LRP6 (NP_002327.2). APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSG
The predicted MW is 180kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About LRP6
O75581 NM_002336 NP_002327.2

Popular LRP6 Products

Anti-LRP6 antibody IHC of human hepatocytes and bile duct. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Monkey, Rat, Dog, Hamster, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Peptide Enzyme-Linked Immunosorbent Assay
Sample (30 ug of whole cell lysate). A: Hep G2. 5% SDS PAGE. LRP6 antibody diluted at 1:500.
Species: Human
Applications: Western blot
Formalin-fixed and paraffin-embedded human breast carcinoma tissue reacted with LRP6 Antibody (C-term T1546), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Species: Human, Mouse
Applications: Western blot, Immunoprecipitation
Immunohistochemistry of paraffin-embedded human gastric cancer using LRP6 antibody at dilution of 1:100 (40x lens).
Species: Human, Mouse, Rat
Applications: IHC, Western blot

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 1/18/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy