Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C747381-20 20 µl $263 
LS-C747381-50 50 µl $301 
LS-C747381-100 100 µl $359 
LS-C747381-200 200 µl $473 
LMPB1 / PAQR8 Antibody - Western blot analysis of extracts of various cell lines, using PAQR8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

Polyclonal Rabbit anti‑Human LMPB1 / PAQR8 Antibody (WB) LS‑C747381

Polyclonal Rabbit anti‑Human LMPB1 / PAQR8 Antibody (WB) LS‑C747381

LMPB1 / PAQR8 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


LMPB1 / PAQR8 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


PAQR8 antibody LS-C747381 is an unconjugated rabbit polyclonal antibody to PAQR8 (LMPB1) from human. It is reactive with human, mouse and rat. Validated for WB.
Human LMPB1 / PAQR8
PAQR8 | C6orf33 | LMPB1 | MPR beta | MPRB
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human PAQR8 (NP_588608.1). MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNE
  • Western blot (1:500 - 1:2000)
The predicted MW is 40kDa, while the observed MW by Western blot was 41kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About LMPB1 / PAQR8
Q8TEZ7 NM_133367 NP_588608.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 10/4/2022