Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

Leptin Antibody LS‑C490331

Western blot Image

Leptin Antibody LS‑C490331

Rabbit Polyclonal to Mouse Leptin
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Mouse Leptin
Unconjugated, Unmodified


Leptin antibody LS-C490331 is an unconjugated rabbit polyclonal antibody to mouse Leptin. Validated for ELISA and WB.
Mouse Leptin
Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • Western blot (0.1 - 0.5 µg/ml)
  • ELISA (0.1 - 0.5 µg/ml)
Leptin antibody was raised against amino acids KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH of mouse Leptin were used as the immunogen for the Leptin antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitute in sterile distilled water.
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About Leptin
P41159 NM_000230 NP_000221.1

Publications (0)

Reviews (0)

Featured Products

Reactivity: Human
Range: 0.94-60 ng/ml
Anti-UCHL1 / PGP9.5 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:200.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Species: Human
Applications: ICC, Western blot, Flow Cytometry, ELISA
Reactivity: Human
Range: 0.312-20 ng/ml
Reactivity: Cynomolgus
Range: 0.7-10 ng/ml

Requested From: United States
Date Requested: 7/22/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy