LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
LASP1 Antibody LS‑C332918
LASP1 antibody LS-C332918 is an unconjugated rabbit polyclonal antibody to LASP1 from human and mouse. Validated for WB.
Catalog
Size
Price
LS-C332918-50
50 µl
$235
LS-C332918-100
100 µl
$295
LS-C332918-200
200 µl
$385
Description
LASP1 antibody LS-C332918 is an unconjugated rabbit polyclonal antibody to LASP1 from human and mouse. Validated for WB.
Target
Human LASP1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:1000 - 1:3000)
Immunogen
LASP1 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1). RMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGK
Specificity
Human LASP1
Usage
The predicted MW is 23kDa/29kDa/36kDa, while the observed MW by Western blot was 37kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About LASP1
Q14847 NM_006148 NP_006139.1

Popular LASP1 Products

Anti-LASP1 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 2.5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
LASP1 antibody. IHC(P): Human Lung Cancer Tissue.
Species: Human, Monkey, Rat, Bovine, Pig, Rabbit, Chicken, Xenopus
Applications: IHC, IHC - Paraffin, ICC, Western blot
Immunohistochemistry of paraffin-embedded human colon cancer using LASP1 Antibody at dilution of 1:100
Species: Human, Mouse
Applications: IHC, Immunofluorescence, Western blot, ELISA
Antibody
Species: Human
Applications: IHC, Immunofluorescence, Western blot, Immunoprecipitation, ELISA
LASP1 antibody IHC-paraffin: Human Placenta Tissue.
Species: Human, Orangutan
Applications: IHC, IHC - Paraffin, Western blot

Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of MCF7 cells.
Western blot analysis of extracts of MCF7 cells.

Western blot

Western blot analysis of extracts of MCF7 cells.
Western blot analysis of extracts of MCF7 cells.

Western blot

Western blot analysis of extracts of MCF7 cells.
Western blot analysis of extracts of MCF7 cells.

Western blot

Western blot analysis of extracts of MCF7 cells.
Western blot analysis of extracts of MCF7 cells.

Requested From: United States
Date Requested: 12/15/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy