Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
LASP1 Antibody LS‑C332918
LASP1 antibody LS-C332918 is an unconjugated rabbit polyclonal antibody to LASP1 from human and mouse. Validated for WB.
50 µl
100 µl
200 µl

Popular LASP1 Products

Anti-LASP1 antibody IHC of human colon. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B4765 concentration 2.5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
LASP1 antibody. IHC(P): Human Lung Cancer Tissue.
Species: Human, Monkey, Rat, Bovine, Pig, Rabbit, Chicken, Xenopus
Applications: IHC, IHC - Paraffin, ICC, Western blot
LASP1 antibody IHC-paraffin: Human Placenta Tissue.
Species: Human, Orangutan
Applications: IHC, IHC - Paraffin, Western blot
Western blot of LASP1 antibody.
Species: Human
Applications: IHC, Western blot
Immunohistochemistry of paraffin-embedded human colon cancer using CSB-PA04629A0Rb at dilution of 1:100
Species: Human, Mouse
Applications: IHC, Immunofluorescence, Western blot, ELISA

Product Description

LASP1 antibody LS-C332918 is an unconjugated rabbit polyclonal antibody to LASP1 from human and mouse. Validated for WB.
About LASP1
Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types. Q14847 NM_006148 NP_006139.1

LASP1 Antibody, LIM and SH3 domain protein 1 Antibody, MLN50 Antibody, Lasp-1 Antibody, LIM and SH3 protein 1 Antibody, MLN 50 Antibody


Human LASP1
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:1000 - 1:3000)
LASP1 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1). RMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGK
Human LASP1
The predicted MW is 23kDa/29kDa/36kDa, while the observed MW by Western blot was 37kDa.
PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of MCF7 cells.
Western blot analysis of extracts of MCF7 cells.

Western blot

Western blot analysis of extracts of MCF7 cells.
Western blot analysis of extracts of MCF7 cells.

Western blot

Western blot analysis of extracts of MCF7 cells.
Western blot analysis of extracts of MCF7 cells.

Western blot

Western blot analysis of extracts of MCF7 cells.
Western blot analysis of extracts of MCF7 cells.

Requested From: United States
Date Requested: 7/20/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number