LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

KLK10 / Kallikrein 10 Antibody IHC-plus™ LS-B15704

Best Seller
Note: This antibody replaces LS-C334686
Kallikrein 10 antibody LS-B15704 is an unconjugated rabbit polyclonal antibody to Kallikrein 10 (KLK10) from human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Catalog
Size
Price
LS-B15704-50
50 µl
$425
Description
Kallikrein 10 antibody LS-B15704 is an unconjugated rabbit polyclonal antibody to Kallikrein 10 (KLK10) from human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human KLK10 / Kallikrein 10
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:100)
  • Immunofluorescence (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 35-276 of human KLK10 (NP_001070968.1). LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Specificity
Human KLK10 / Kallikrein 10
Usage
The predicted MW is 30kDa, while the observed MW by Western blot was 33kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About KLK10 / Kallikrein 10
O43240 NM_002776 NP_002767.2

Popular KLK10 / Kallikrein 10 Products

Immunohistochemical analysis of KLK10 staining in human liver cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
Immunohistochemistry of paraffin-embedded human prostata cancer at dilution 1:100
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Antibody
Species: Human
Applications: IHC, Western blot, ELISA
Immunohistochemistry - Paraffin Image
Species: Human
Applications: IHC, Western blot

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry - Paraffin

Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human prostate.
Immunohistochemistry of paraffin-embedded human prostate.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human liver cancer tissue.
Immunohistochemistry of paraffin-embedded human liver cancer tissue.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Immunohistochemistry - Paraffin

Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human prostate.
Immunohistochemistry of paraffin-embedded human prostate.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human liver cancer tissue.
Immunohistochemistry of paraffin-embedded human liver cancer tissue.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Immunohistochemistry - Paraffin

Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human prostate.
Immunohistochemistry of paraffin-embedded human prostate.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human liver cancer tissue.
Immunohistochemistry of paraffin-embedded human liver cancer tissue.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Immunohistochemistry - Paraffin

Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human prostate.
Immunohistochemistry of paraffin-embedded human prostate.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human liver cancer tissue.
Immunohistochemistry of paraffin-embedded human liver cancer tissue.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Requested From: United States
Date Requested: 4/25/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy