LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
KLF4 Antibody IHC‑plus™ LS‑B14137
Note: This antibody replaces LS-C409004
KLF4 antibody LS-B14137 is an unconjugated rabbit polyclonal antibody to KLF4 from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Catalog
Size
Price
LS-B14137-50
50 µl
$425
Description
KLF4 antibody LS-B14137 is an unconjugated rabbit polyclonal antibody to KLF4 from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human KLF4
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
KLF4 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 180-479 of human KLF4 (NP_004226.3). PPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Specificity
Human KLF4
Usage
The predicted MW is 6kDa/12kDa/45kDa/51kDa/54kDa, while the observed MW by Western blot was 50kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About KLF4
O43474 NM_004235 NP_004226.3

Popular KLF4 Products

Anti-KLF4 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 20 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Anti-KLF4 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila
Applications: IHC, IHC - Paraffin, Western blot
Immunofluorescence of KLF4 antibody (5 ug/ml). HeLa cells transfected with pMX constructs of human KLF4 (top) and NIH3T3 cells transfected with pMX constructs of mouse KLF4 (bottom) were analyzed at approximately 62 hours after transfection.
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry
Anti-KLF4 antibody IHC of human melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Bovine, Dog, Horse, Pig, Sheep
Applications: IHC, IHC - Paraffin, Western blot
Antibody (0.1 ug/ml) staining of Human Duodenum lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry - Paraffin

Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot blot of extracts of various cell lines, using KLF4 antibody.
Western blot blot of extracts of various cell lines, using KLF4 antibody.

Immunohistochemistry - Paraffin

Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot blot of extracts of various cell lines, using KLF4 antibody.
Western blot blot of extracts of various cell lines, using KLF4 antibody.

Immunohistochemistry - Paraffin

Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot blot of extracts of various cell lines, using KLF4 antibody.
Western blot blot of extracts of various cell lines, using KLF4 antibody.

Immunohistochemistry - Paraffin

Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot blot of extracts of various cell lines, using KLF4 antibody.
Western blot blot of extracts of various cell lines, using KLF4 antibody.

Requested From: United States
Date Requested: 11/17/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy