Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331306-20 20 µl $287 
LS-C331306-50 50 µl $329 
LS-C331306-100 100 µl $407 
LS-C331306-200 200 µl $509 
KDM1A / LSD1 Antibody - Immunohistochemistry of paraffin-embedded rat kidney tissue.
KDM1A / LSD1 Antibody - Immunofluorescence analysis of A549 cells using KDM1A antibody.
KDM1A / LSD1 Antibody - Immunofluorescence analysis of HeLa cells.
KDM1A / LSD1 Antibody - Western blot analysis of extracts from normal (control) and KDM1A knockout (KO) HeLa cells, using KDM1A antibodyat 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
KDM1A / LSD1 Antibody - Western blot analysis of extracts of various cell lines, using KDM1A antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
KDM1A / LSD1 Antibody - Western blot analysis of extracts of various cell lysates.
KDM1A / LSD1 Antibody - Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug KDM1A antibody. Western blot was performed from the immunoprecipitate using KDM1A antibodyat a dilition of 1:500.
KDM1A / LSD1 Antibody - Immunohistochemistry of paraffin-embedded rat kidney tissue.
KDM1A / LSD1 Antibody - Immunofluorescence analysis of A549 cells using KDM1A antibody.
KDM1A / LSD1 Antibody - Immunofluorescence analysis of HeLa cells.
KDM1A / LSD1 Antibody - Western blot analysis of extracts from normal (control) and KDM1A knockout (KO) HeLa cells, using KDM1A antibodyat 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
KDM1A / LSD1 Antibody - Western blot analysis of extracts of various cell lines, using KDM1A antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
KDM1A / LSD1 Antibody - Western blot analysis of extracts of various cell lysates.
KDM1A / LSD1 Antibody - Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug KDM1A antibody. Western blot was performed from the immunoprecipitate using KDM1A antibodyat a dilition of 1:500.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human KDM1A / LSD1 Antibody (IHC, IF, WB) LS‑C331306

Polyclonal Rabbit anti‑Human KDM1A / LSD1 Antibody (IHC, IF, WB) LS‑C331306

Antibody:
KDM1A / LSD1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP, ChIP-Seq
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$287
LS-C331306-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
KDM1A / LSD1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP, ChIP-Seq
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
LSD1 antibody LS-C331306 is an unconjugated rabbit polyclonal antibody to LSD1 (KDM1A) from human. It is reactive with human, mouse and rat. Validated for ChIP-Seq, IF, IHC, IP and WB.
Target
Human KDM1A / LSD1
Synonyms
KDM1A | BHC110 | KDM1 | LSD1 | AOF2 | KIAA0601
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 130-380 of human KDM1A (NP_055828.2). LSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQ
Specificity
Human KDM1A / LSD1
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:50 - 1:200)
  • ChIP-sequencing (1:20 - 1:100)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 92kDa/95kDa, while the observed MW by Western blot was 96-117kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About KDM1A / LSD1
O60341 NM_015013 NP_055828.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/9/2022