Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C498039-50 50 µl $235 
LS-C498039-100 100 µl $295 
LS-C498039-200 200 µl $385 
Antibody

KCNJ9 / Kir3.3 / GIRK3 Antibody LS‑C498039

KCNJ9 / Kir3.3 / GIRK3 Antibody LS‑C498039

Antibody:
Rabbit Polyclonal to Human KCNJ9 / Kir3.3 / GIRK3
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C498039-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human KCNJ9 / Kir3.3 / GIRK3
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
GIRK3 antibody LS-C498039 is an unconjugated rabbit polyclonal antibody to GIRK3 (KCNJ9 / Kir3.3 ) from mouse and rat. Validated for WB.
Target
Human KCNJ9 / Kir3.3 / GIRK3
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCNJ9 (NP_004974.2). MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPC
Usage
The predicted MW is 44kDa, while the observed MW by Western blot was Refer to Figures.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About KCNJ9 / Kir3.3 / GIRK3
Q92806 NM_004983 NP_004974.2

Publications (0)

Reviews (0)

Featured Products

KCNJ9 / Kir3.3 / GIRK3 Antibody - Anti-KCNJ9 / Kir3.3 antibody IHC of human brain, cortex neurons. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:200.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
KCNJ9 / Kir3.3 / GIRK3 Antibody - Immunohistochemical analysis of Kir3.3 staining in human brain formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot
NF-L / NEFL ELISA Kit
Reactivity: Mouse
Range: 15.6-1000 pg/ml
NOG / Noggin ELISA Kit
Reactivity: Mouse
Range: 31.25-2000 pg/ml
CTx-II ELISA Kit
Reactivity: Human
Range: 0.16-10 ng/ml

Requested From: United States
Date Requested: 10/17/2019