Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C24751-100 100 µg $613 

Monoclonal Mouse anti‑Human ITGA3 / CD49c Antibody (clone 29A3, Cytoplasmic Domain, IHC, WB) LS‑C24751

Monoclonal Mouse anti‑Human ITGA3 / CD49c Antibody (clone 29A3, Cytoplasmic Domain, IHC, WB) LS‑C24751

Note: This antibody replaces LS-C24752
ITGA3 / CD49c Mouse anti-Human Monoclonal (Cytoplasmic Domain) (29A3) Antibody
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


ITGA3 / CD49c Mouse anti-Human Monoclonal (Cytoplasmic Domain) (29A3) Antibody
Unconjugated, Unmodified


CD49c antibody LS-C24751 is an unconjugated mouse monoclonal antibody to human CD49c (ITGA3) (Cytoplasmic Domain). Validated for ICC, IHC and WB.
Human ITGA3 / CD49c
ITGA3 | Alpha3 integrin | CD49c antigen | CD49C | GAPB3 | Integrin alpha-3 | FRP-2 | VCA-2 | VLA-3 subunit alpha | VL3A | VLA3a | Galactoprotein B3 | GAP-B3 | ILNEB | Integrin alpha3 | MSK18
Human (tested or 100% immunogen sequence identity)
IgG1 Monoclonal
Protein G purified
Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-Terminus cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Cytoplasmic Domain
Recognizes specifically the cytoplasmic domain of human integrin subunit a3A which is present in the basal cell layer in skin, glomeruli, Bowman’s capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.
  • IHC
  • IHC - Frozen
  • ICC
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunohistochemistry (frozen): 1:100 - 1:200 using avidn-biotinylated HRP complex (ABC) as detection reagent. Western Blot: 1:100 - 1:1000. Optimum dilutions to be determined by researcher.
PBS, pH 7.2, 0.1% Sodium Azide, No stabilizing proteins added
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ITGA3 / CD49c
P26006 NM_002204 NP_002195.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 8/18/2022