Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C146757-0.1 0.1 mg $375 
ITGA3 / CD49c Antibody - Immunofluorescent staining on frozen sections of dog skin.
ITGA3 / CD49c Antibody - Immunofluorescent staining on frozen section of human skin
ITGA3 / CD49c Antibody - Immunofluorescent staining on frozen sections of dog skin.
ITGA3 / CD49c Antibody - Immunofluorescent staining on frozen section of human skin
1 of 2
2 of 2

ITGA3 / CD49c Antibody (clone 158A3) LS‑C146757

ITGA3 / CD49c Antibody (clone 158A3) LS‑C146757

Note: This antibody replaces LS-C147841
Antibody:
Mouse Monoclonal to Human ITGA3 / CD49c
Application:
IHC, IHC-Fr, ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$375 
LS-C146757-0.1
0.1 mg
Toll Free North America
866-819-4732

Overview

Antibody:
Mouse Monoclonal to Human ITGA3 / CD49c
Application:
IHC, IHC-Fr, ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
CD49c antibody LS-C146757 is an unconjugated mouse monoclonal antibody to human CD49c (ITGA3 ). Validated for ICC, IHC and WB.
Target
Human ITGA3 / CD49c
Host
Mouse
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG2a Monoclonal
Clone
158A3
Conjugations
Unconjugated
Purification
Purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Frozen (1:100 - 1:200)
  • ICC
  • Western blot (1:100 - 1:1000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Failed Applications
  • IHC - Paraffin
Immunogen
Peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin
Specificity
Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha-3A. A broad species reactivity is expected because of the conserved nature of the epitope.
Presentation
PBS, 0.09% Sodium Azide
Storage
Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles. Store undiluted.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ITGA3 / CD49c
P26006 NM_002204 NP_002195.1

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 11/11/2019