LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
IRF5 Antibody LS‑C331297
IRF5 antibody LS-C331297 is an unconjugated rabbit polyclonal antibody to IRF5 from human and rat. Validated for IF, IHC and WB.
Catalog
Size
Price
LS-C331297-50
50 µl
$235
LS-C331297-100
100 µl
$315
LS-C331297-200
200 µl
$425
Description
IRF5 antibody LS-C331297 is an unconjugated rabbit polyclonal antibody to IRF5 from human and rat. Validated for IF, IHC and WB.
Target
Human IRF5
Host
Rabbit
Reactivity
Human, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
IRF5 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRF5 (NP_001092097.2). MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPL
Specificity
Human IRF5
Usage
The predicted MW is 17kDa/47kDa/54kDa/56kDa/57kDa, while the observed MW by Western blot was 57kDa/60kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About IRF5
Q13568 NM_002200 NP_116032.1

Popular IRF5 Products

Immunoperoxidase of monoclonal antibody to IRF5 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.8 ug/ml]
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
IRF5 antibody Western blot of SH-SYSY lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bovine, Dog, Horse, Pig, Rabbit, Zebrafish
Applications: Western blot
Immunoperoxidase of monoclonal antibody to IRF5 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Confocal immunofluorescence of IRF5 Antibody with A549 cell followed by Alexa Fluor 489-conjugated goat anti-rabbit lgG (green). DAPI was used to stain the cell nuclear (blue).
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry
Antibody
Species: Mouse, Rat
Applications: Western blot, Immunoprecipitation, ELISA

Publications (0)


Customer Reviews (0)


Images

Immunofluorescence

Immunofluorescence analysis of HeLa cells using IRF5 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using IRF5 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using IRF5 antibody.
Western blot analysis of extracts of various cell lines, using IRF5 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using IRF5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using IRF5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Immunofluorescence

Immunofluorescence analysis of HeLa cells using IRF5 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using IRF5 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using IRF5 antibody.
Western blot analysis of extracts of various cell lines, using IRF5 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using IRF5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using IRF5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Immunofluorescence

Immunofluorescence analysis of HeLa cells using IRF5 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using IRF5 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using IRF5 antibody.
Western blot analysis of extracts of various cell lines, using IRF5 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using IRF5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using IRF5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Immunofluorescence

Immunofluorescence analysis of HeLa cells using IRF5 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using IRF5 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using IRF5 antibody.
Western blot analysis of extracts of various cell lines, using IRF5 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using IRF5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using IRF5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Requested From: United States
Date Requested: 11/18/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy