Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
IRF2 Antibody LS‑C490320
IRF2 antibody LS-C490320 is an unconjugated rabbit polyclonal antibody to IRF2 from human and rat. Validated for WB.
100 µg

Popular IRF2 Products

Staining (2?g/ml) of Jurkat lysate (RIPA buffer, 30?g total protein per lane). Primary incubated for 1 hour. Detected by western blot using chemiluminescence.
Species: Human, Monkey, Mouse, Rat, Dog, Hamster, Horse
Applications: Western blot
Immunoperoxidase of monoclonal antibody to IRF2 on formalin-fixed paraffin-embedded human leiomyosarcoma. [antibody concentration 3 ug/ml]
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Immunohistochemistry of paraffin-embedded human stomach cancer tissue.
Species: Human, Mouse, Rat
Applications: IHC, Immunofluorescence, Western blot
Species: Human
Applications: IHC, Western blot, Immunoprecipitation, ELISA
Immunohistochemistry - Paraffin Image
Species: Human
Applications: IHC, ICC, Immunofluorescence, Western blot

Product Description

IRF2 antibody LS-C490320 is an unconjugated rabbit polyclonal antibody to IRF2 from human and rat. Validated for WB.
About IRF2
Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. P14316 NM_002199 NP_002190.2

IRF2 Antibody, IRF-2 Antibody, Interferon regulatory factor 2 Antibody


Human IRF2
Human, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • Western blot (0.1 - 0.5 µg/ml)
IRF2 antibody was raised against amino acids MTPASSSSRPDRETRASVIKKTSDITQARVKS of human IRF2 were used as the immunogen for the IRF2 antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Sterile distilled water
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.

Publications (0)

Customer Reviews (0)


Western blot

Western blot

Western blot

Western blot

Requested From: United States
Date Requested: 7/21/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number