Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
IRF2 Antibody LS‑C490320
IRF2 antibody LS-C490320 is an unconjugated rabbit polyclonal antibody to IRF2 from human and rat. Validated for WB.
100 µg
IRF2 antibody LS-C490320 is an unconjugated rabbit polyclonal antibody to IRF2 from human and rat. Validated for WB.
Human IRF2
Human, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • Western blot (0.1 - 0.5 µg/ml)
IRF2 antibody was raised against amino acids MTPASSSSRPDRETRASVIKKTSDITQARVKS of human IRF2 were used as the immunogen for the IRF2 antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Sterile distilled water
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About IRF2
P14316 NM_002199 NP_002190.2

Popular IRF2 Products

Species: Human, Mouse
Applications: Western blot, ELISA
HEK293 overexpressing  IRF2 (RC202102) and probed (mock transfection in first lane)
Species: Human, Monkey, Mouse, Rat, Dog, Hamster, Horse
Applications: Western blot
Jurkat Cell Lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep
Applications: Western blot
Immunoperoxidase of monoclonal antibody to IRF2 on formalin-fixed paraffin-embedded human leiomyosarcoma. [antibody concentration 3 ug/ml]
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Immunohistochemistry - Paraffin Image
Species: Human
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot

Publications (0)

Customer Reviews (0)


Western blot

Western blot

Western blot

Western blot

Requested From: United States
Date Requested: 11/18/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy