LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Integrin Alpha 3B/6B Antibody (clone PB36) LS‑C146759

Catalog Number Size Price
LS-C146759-0.1 0.1 mg $375 
Immunofluorescent staining on frozen section of human kidney

Integrin Alpha 3B/6B Antibody (clone PB36) LS‑C146759

Note: This antibody replaces LS-C147843
Antibody:
Mouse Monoclonal to Human Integrin Alpha 3B/6B
Application:
IHC, IHC-Fr, ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$375 
LS-C146759-0.1
Toll Free North America
866-819-4732

Overview

Antibody:
Mouse Monoclonal to Human Integrin Alpha 3B/6B
Application:
IHC, IHC-Fr, ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
6B antibody LS-C146759 is an unconjugated mouse monoclonal antibody to human 6B (Integrin Alpha 3B). Validated for ICC, IHC and WB.
Target
Human Integrin Alpha 3B/6B
Host
Mouse
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG1 Monoclonal
Clone
PB36
Conjugations
Unconjugated
Purification
Purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Frozen (1:50 - 1:100)
  • ICC
  • Western blot (1:100 - 1:500)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Failed Applications
  • IHC - Paraffin
Immunogen
Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha-3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin
Specificity
Recognizes the cytoplasmic domain of integrin subunits alpha-3B and alpha-6B. Reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart. A broad species reactivity is expected because of the conserved nature of the epitope.
Presentation
PBS, 0.09% Sodium Azide
Storage
Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles. Store undiluted.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee

Publications (0)

Reviews (0)

Featured Products

Product
Species: Human
Applications: IHC, IHC - Frozen, ICC, Western blot
Reactivity: Human
Range: 1.37-1000 pg/ml
Reactivity: Human
Range: 0.312-20 ng/ml
Product
Species: Mouse, Human
Applications: Western blot, Immunoprecipitation, Flow Cytometry

Requested From: United States
Date Requested: 8/17/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy