Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

INHBC Antibody (Biotin) LS-C523177


INHBC Antibody (Biotin) LS-C523177

Mouse Monoclonal to Human INHBC
Human, Rat
Biotin, Unmodified
Other formats:
Catalog Number
Toll Free North America


Mouse Monoclonal to Human INHBC
Human, Rat
Biotin, Unmodified
Other formats:


INHBC antibody LS-C523177 is a biotin-conjugated mouse monoclonal antibody to INHBC from human and rat. Validated for ELISA, IHC and WB.

Human, Rat (tested or 100% immunogen sequence identity)
IgG1 Monoclonal
Biotin. Also available conjugated with AP, FITC, HRP, PE.
Protein G purified
  • IHC
  • Western blot
  • (applications tested for the base form of this product only)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
INHBC antibody was raised against synthetic peptide, VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC, corresponding to aa82-113 of mature human activin BetaC-subunit.
Recognizes human Activin B. Species cross-reactivity: rat.
PBS, pH 7.2
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
P55103 NM_005538 NP_005529.1

Publications (0)

Reviews (0)

Featured Products

Reactivity: Human
Range: 10.24-2500 pg/ml
Anti-UCHL1 / PGP9.5 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:200.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Reactivity: Human
Range: 62.5-4000 pg/ml

Requested From: United States
Date Requested: 7/16/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy