Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

IL21 Receptor Antibody (aa35‑64) LS‑C83978

Catalog Number Size Price
LS-C83978-200 200 µg $455 
Antibody

IL21 Receptor Antibody (aa35‑64) LS‑C83978

Note: This antibody replaces LS-C8221, LS-C8218, LS-C70989
Antibody:
Goat Polyclonal to Human IL21 Receptor
Application:
IHC, ELISA
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$455 
LS-C83978-200
Toll Free North America
866-819-4732

Overview

Antibody:
Goat Polyclonal to Human IL21 Receptor
Application:
IHC, ELISA
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
IL21 Receptor antibody LS-C83978 is an unconjugated goat polyclonal antibody to human IL21 Receptor. Validated for ELISA and IHC.
Target
Human IL21 Receptor
Host
Goat
Reactivity
Human (tested or 100% immunogen sequence identity)
Predicted
Monkey (at least 90% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Applications
  • IHC
  • ELISA (1:100000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Failed Applications
  • IHC - Paraffin
Immunogen
Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor. Percent identity by BLAST analysis: Human (100%); Gibbon, Marmoset (97%).
Epitope
aa35-64
Specificity
Peptide sequence is <50 % identical to other sequences in GenBank. The antibody recognizes human IL-21 receptor and was not tested for cross-reactivity to mouse IL-21 receptor.
Presentation
10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide
Storage
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL21 Receptor
Q9HBE5 NM_021798 NP_068570.1

Publications (0)

Reviews (0)

Featured Products

Staining of C57Bl/6 splenocytes with 0.25 ug of Biotin Rat IgG2a isotype control (open histogram) or 0.25 ug of Biotin anti-mouse IL-21R antibody (colored histogram) followed by SAv-PE. Cells in the lymphocyte gate were used for analysis. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse
Applications: Flow Cytometry
Staining of BALB/c splenocytes with 0.25 ug of PE Rat IgG2a isotype control (open histogram) or PE anti-mouse IL-21R antibody (colored histogram). Total viable cells were used for analysis. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse
Applications: Flow Cytometry
Western blot of IL-21R in 30 ugs of Raji cell lysate using antibody at 1 ug/ml.
Species: Human, Monkey
Applications: Western blot, ELISA
Product
Species: Mouse
Applications: IHC, Flow Cytometry, ELISA
Product
Species: Mouse
Applications: IHC, Flow Cytometry, ELISA
Reactivity: Human
Range: 0.156-10 ng/ml

Requested From: United States
Date Requested: 9/16/2019