Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C83978-200 200 µg $455 

Polyclonal Goat anti‑Human IL21 Receptor Antibody (aa35‑64) LS‑C83978

Polyclonal Goat anti‑Human IL21 Receptor Antibody (aa35‑64) LS‑C83978

Note: This antibody replaces LS-C8221, LS-C8218, LS-C70989
Goat Polyclonal to Human IL21 Receptor
Unconjugated, Unmodified
Catalog Number
200 µg
Toll Free North America
For Research Use Only


Goat Polyclonal to Human IL21 Receptor
Unconjugated, Unmodified


IL21 Receptor antibody LS-C83978 is an unconjugated goat polyclonal antibody to human IL21 Receptor (aa35-64). Validated for ELISA.
Human IL21 Receptor
IL21R | CD360 | Interleukin 21 receptor | Interleukin-21 receptor | NILR | IL-21 receptor | CD360 antigen | IL-21R | IL21 Receptor | Novel interleukin receptor
Human (tested or 100% immunogen sequence identity)
Monkey (at least 90% immunogen sequence identity)
Immunoaffinity purified
  • ELISA (1:100000)
Failed Applications
  • IHC - Paraffin
Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-Terminus of human IL-21 receptor. Percent identity by BLAST analysis: Human (100%); Gibbon, Marmoset (97%).
Peptide sequence is <50 % identical to other sequences in GenBank. The antibody recognizes human IL-21 receptor and was not tested for cross-reactivity to mouse IL-21 receptor.
10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL21 Receptor
Q9HBE5 NM_021798 NP_068570.1

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 7/7/2020