Products
Services
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C83977-200 200 µg $455 
Antibody

Polyclonal Rabbit anti‑Mouse IL21 Receptor Antibody (aa35‑64, IHC) LS‑C83977

Polyclonal Rabbit anti‑Mouse IL21 Receptor Antibody (aa35‑64, IHC) LS‑C83977

Note: This antibody replaces LS-C8220, LS-C8219, LS-C70990
Antibody:
Rabbit Polyclonal to Mouse IL21 Receptor
Application:
IHC, Flo, ELISA
Reactivity:
Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$455 
LS-C83977-200
200 µg
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
Rabbit Polyclonal to Mouse IL21 Receptor
Application:
IHC, Flo, ELISA
Reactivity:
Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
IL21 Receptor antibody LS-C83977 is an unconjugated rabbit polyclonal antibody to mouse IL21 Receptor (aa35-64). Validated for ELISA, Flow and IHC.
Target
Mouse IL21 Receptor
Synonyms
IL21R | CD360 | Interleukin 21 receptor | Interleukin-21 receptor | NILR | IL-21 receptor | CD360 antigen | IL-21R | IL21 Receptor | Novel interleukin receptor
Host
Rabbit
Reactivity
Mouse (tested or 100% immunogen sequence identity)
Predicted
Rat (at least 90% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Applications
  • IHC
  • Flow Cytometry
  • ELISA (1:100000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-Terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%); Rat (90%).
Epitope
aa35-64
Specificity
Peptide sequence is <50 % identical to other sequences in GenBank. The antibody recognizes mouse IL-21 receptor. Not tested for cross-reactivity to human IL-21 receptor.
Presentation
10 mM Potassium Phosphate, 140 mM NaCl, 1 mg/ml BSA, 0.1% Sodium Azide
Storage
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL21 Receptor
Q9HBE5 NM_021798 NP_068570.1

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 7/13/2020