LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
IL1RN Antibody IHC‑plus™ LS‑B14528
Note: This antibody replaces LS-C335202
IL1RN antibody LS-B14528 is an unconjugated rabbit polyclonal antibody to IL1RN from human and mouse. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Catalog
Size
Price
LS-B14528-50
50 µl
$425
Description
IL1RN antibody LS-B14528 is an unconjugated rabbit polyclonal antibody to IL1RN from human and mouse. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human IL1RN
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (1:100)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
IL1RN antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-159 of human IL1RN (NP_000568.1). MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Specificity
Human IL1RN
Usage
The predicted MW is 16kDa/17kDa/19kDa/20kDa, while the observed MW by Western blot was 23kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About IL1RN
P18510 NM_000577 NP_000568.1

Popular IL1RN Products

Western blot of IL1RN expression in transfected 293T cell line by IL1RN monoclonal antibody (M03), clone 1H5.
Species: Human
Applications: Western blot, Immunoprecipitation, ELISA
Antibody
Species: Human
Applications: ELISA
Human peripheral blood mononuclear cells were stimulated with intracellularly stained with FITC mouse IgG1 isotype control. The cells were surface stained with PE anti-human CD14 and intracellularly stained with FITC anti-human IL-1RA (CRM17). This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: Flow Cytometry
Antibody
Species: Human
Applications: ELISA
IL1RN Antibody (RB18901) IHC of formalin-fixed and paraffin-embedded human Colon carcinoma followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Flow Cytometry

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry - Paraffin

Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunofluorescence

Immunofluorescence analysis of MCF7 cell using IL1RN antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of MCF7 cell using IL1RN antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using IL1RN antibody.
Western blot analysis of extracts of various cell lines, using IL1RN antibody.

Immunohistochemistry - Paraffin

Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunofluorescence

Immunofluorescence analysis of MCF7 cell using IL1RN antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of MCF7 cell using IL1RN antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using IL1RN antibody.
Western blot analysis of extracts of various cell lines, using IL1RN antibody.

Immunohistochemistry - Paraffin

Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunofluorescence

Immunofluorescence analysis of MCF7 cell using IL1RN antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of MCF7 cell using IL1RN antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using IL1RN antibody.
Western blot analysis of extracts of various cell lines, using IL1RN antibody.

Immunohistochemistry - Paraffin

Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunofluorescence

Immunofluorescence analysis of MCF7 cell using IL1RN antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of MCF7 cell using IL1RN antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using IL1RN antibody.
Western blot analysis of extracts of various cell lines, using IL1RN antibody.

Requested From: United States
Date Requested: 11/16/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy