Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C746775-20 20 µl $215 
LS-C746775-50 50 µl $235 
LS-C746775-100 100 µl $295 
LS-C746775-200 200 µl $385 
IL1A / IL-1 Alpha Antibody - Immunohistochemistry of paraffin-embedded mouse brain using IL1A antibody at dilution of 1:100 (40x lens).
IL1A / IL-1 Alpha Antibody - Immunohistochemistry of paraffin-embedded human esophagus using IL1A antibody at dilution of 1:100 (40x lens).
IL1A / IL-1 Alpha Antibody - Western blot analysis of extracts of various cell lines, using IL1A antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
IL1A / IL-1 Alpha Antibody - Immunohistochemistry of paraffin-embedded mouse brain using IL1A antibody at dilution of 1:100 (40x lens).
IL1A / IL-1 Alpha Antibody - Immunohistochemistry of paraffin-embedded human esophagus using IL1A antibody at dilution of 1:100 (40x lens).
IL1A / IL-1 Alpha Antibody - Western blot analysis of extracts of various cell lines, using IL1A antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
1 of 3
2 of 3
3 of 3

Polyclonal IL1A / IL‑1 Alpha Antibody (IHC, WB) LS‑C746775

Polyclonal IL1A / IL‑1 Alpha Antibody (IHC, WB) LS‑C746775

Antibody:
Rabbit Polyclonal to Human IL1A / IL-1 Alpha
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$215 
LS-C746775-20
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human IL1A / IL-1 Alpha
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
IL-1 Alpha antibody LS-C746775 is an unconjugated rabbit polyclonal antibody to IL-1 Alpha (IL1A ) from human and mouse. Validated for IHC and WB.
Target
Human IL1A / IL-1 Alpha
Synonyms
IL1A | Hematopoietin-1 | IL-1 alpha | IL1 | IL1-ALPHA | IL1 Alpha | Interleukin-1 alpha | IL-1A | IL1F1 | Pro-interleukin-1-alpha | Preinterleukin 1 alpha | Interleukin 1, alpha
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 112-271 of human IL1A (NP_000566.3). RSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Usage
The predicted MW is 30kDa, while the observed MW by Western blot was 36kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL1A / IL-1 Alpha
P01583 NM_000575 NP_000566.3

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 2/22/2020