LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
IL13 Antibody LS‑C331885
IL13 antibody LS-C331885 is an unconjugated rabbit polyclonal antibody to IL13 from human, mouse and rat. Validated for IHC and WB.
Catalog
Size
Price
LS-C331885-50
50 µl
Unavailable
LS-C331885-100
100 µl
Unavailable
LS-C331885-200
200 µl
Unavailable

Popular IL13 Products

Antibody
Species: Human
Applications: IHC, IHC - Frozen, Western blot, ELISA, Neutralization
Antibody
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry, ELISA, Sandwich ELISA
Antibody
Species: Mouse
Applications: ELISA
Anti-IL-13 antibody IHC of rat spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B3767 concentration 10 ug/ml.
Species: Rat
Applications: IHC, IHC - Paraffin, Flow Cytometry, ELISA
Anti-IL-13 antibody IHC of human tonsil, germinal center. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7417 concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA, Neutralization

Product Description

IL13 antibody LS-C331885 is an unconjugated rabbit polyclonal antibody to IL13 from human, mouse and rat. Validated for IHC and WB.
About IL13
IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. P35225 NM_002188 NP_002179.2

IL13 Antibody, ALRH Antibody, BHR1 Antibody, Interleukin-13 Antibody, NC30 Antibody, p600 Antibody, IL-13 Antibody, Interleukin 13 Antibody


Specifications

Target
Human IL13
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
IL13 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 25-146 of human IL13 (NP_002179.2). LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Specificity
Human IL13
Usage
The predicted MW is 15kDa, while the observed MW by Western blot was 15kDa.
Presentation
PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach tissue.
Immunohistochemistry of paraffin-embedded human stomach tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse brain tissue.
Immunohistochemistry of paraffin-embedded mouse brain tissue.

Western blot

Western blot analysis of extracts of recombinant protein.
Western blot analysis of extracts of recombinant protein.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach tissue.
Immunohistochemistry of paraffin-embedded human stomach tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse brain tissue.
Immunohistochemistry of paraffin-embedded mouse brain tissue.

Western blot

Western blot analysis of extracts of recombinant protein.
Western blot analysis of extracts of recombinant protein.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach tissue.
Immunohistochemistry of paraffin-embedded human stomach tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse brain tissue.
Immunohistochemistry of paraffin-embedded mouse brain tissue.

Western blot

Western blot analysis of extracts of recombinant protein.
Western blot analysis of extracts of recombinant protein.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach tissue.
Immunohistochemistry of paraffin-embedded human stomach tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse brain tissue.
Immunohistochemistry of paraffin-embedded mouse brain tissue.

Western blot

Western blot analysis of extracts of recombinant protein.
Western blot analysis of extracts of recombinant protein.

Requested From: 
Date Requested: 7/20/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number