Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
IL13 Antibody LS‑C331885
IL13 antibody LS-C331885 is an unconjugated rabbit polyclonal antibody to IL13 from human, mouse and rat. Validated for IHC and WB.
50 µl
100 µl
200 µl
IL13 antibody LS-C331885 is an unconjugated rabbit polyclonal antibody to IL13 from human, mouse and rat. Validated for IHC and WB.
Human IL13
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
IL13 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 25-146 of human IL13 (NP_002179.2). LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Human IL13
The predicted MW is 15kDa, while the observed MW by Western blot was 15kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About IL13
P35225 NM_002188 NP_002179.2

Popular IL13 Products

Anti-IL-13 antibody IHC of rat spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Rat
Applications: IHC, IHC - Paraffin, Flow Cytometry, ELISA
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry, ELISA, Sandwich ELISA
Species: Human
Applications: IHC, IHC - Frozen, Western blot, ELISA, Neutralization
Anti-IL-13 antibody IHC of human tonsil, germinal center. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Species: Mouse
Applications: ELISA

Publications (0)

Customer Reviews (0)



Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.


Immunohistochemistry of paraffin-embedded human stomach tissue.
Immunohistochemistry of paraffin-embedded human stomach tissue.


Immunohistochemistry of paraffin-embedded mouse brain tissue.
Immunohistochemistry of paraffin-embedded mouse brain tissue.

Western blot

Western blot analysis of extracts of recombinant protein.
Western blot analysis of extracts of recombinant protein.


Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.


Immunohistochemistry of paraffin-embedded human stomach tissue.
Immunohistochemistry of paraffin-embedded human stomach tissue.


Immunohistochemistry of paraffin-embedded mouse brain tissue.
Immunohistochemistry of paraffin-embedded mouse brain tissue.

Western blot

Western blot analysis of extracts of recombinant protein.
Western blot analysis of extracts of recombinant protein.


Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.


Immunohistochemistry of paraffin-embedded human stomach tissue.
Immunohistochemistry of paraffin-embedded human stomach tissue.


Immunohistochemistry of paraffin-embedded mouse brain tissue.
Immunohistochemistry of paraffin-embedded mouse brain tissue.

Western blot

Western blot analysis of extracts of recombinant protein.
Western blot analysis of extracts of recombinant protein.


Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.


Immunohistochemistry of paraffin-embedded human stomach tissue.
Immunohistochemistry of paraffin-embedded human stomach tissue.


Immunohistochemistry of paraffin-embedded mouse brain tissue.
Immunohistochemistry of paraffin-embedded mouse brain tissue.

Western blot

Western blot analysis of extracts of recombinant protein.
Western blot analysis of extracts of recombinant protein.

Requested From: United States
Date Requested: 11/17/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy