Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13375-50 50 µl $460 
TSG101 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
TSG101 Antibody - Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
TSG101 Antibody - Western blot analysis of extracts of HeLa cell line, using TSG101 antibody.
TSG101 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
TSG101 Antibody - Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
TSG101 Antibody - Western blot analysis of extracts of HeLa cell line, using TSG101 antibody.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Polyclonal Rabbit anti‑Human TSG101 Antibody (IHC, WB) LS‑B13375

IHC‑plus™ Polyclonal Rabbit anti‑Human TSG101 Antibody (IHC, WB) LS‑B13375

Note: This antibody replaces LS-C331996
Antibody:
TSG101 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13375-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
TSG101 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
TSG101 antibody LS-B13375 is an unconjugated rabbit polyclonal antibody to TSG101 from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human TSG101
Synonyms
TSG101 | ESCRT-I complex subunit TSG101 | Tumor susceptibility gene 10 | Tumor susceptibility protein | VPS23 | Tumor susceptibility gene 101 | TSG10
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human TSG101 (NP_006283.1). SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Specificity
Human TSG101
Applications
  • IHC
  • IHC - Paraffin (1:100)
  • Western blot (1:200 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 31kDa/43kDa, while the observed MW by Western blot was 48kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TSG101
Q99816 NM_006292 NP_006283.1

Validation

TSG101 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

TSG101 Antibody - Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ TSG101 Antibody for IHC, WB/Western LS-B13375 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/28/2021