Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

IHCPlus™ TNK2 / ACK1 Antibody Polyclonal IF,IHC,WB LS‑B12327

Catalog Number Size Price
LS-B12327-50 50 µl $425 
Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Immunofluorescence analysis of U2OS cell using TNK2 antibody. Blue: DAPI for nuclear staining.
Western blot analysis of extracts of various cell lines, using TNK2 antibody.
Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Immunofluorescence analysis of U2OS cell using TNK2 antibody. Blue: DAPI for nuclear staining.
Western blot analysis of extracts of various cell lines, using TNK2 antibody.
1 of 4
2 of 4
3 of 4
4 of 4

IHCPlus™ TNK2 / ACK1 Antibody Polyclonal IF,IHC,WB LS‑B12327

Note: This antibody replaces LS-C332144
Antibody:
Rabbit Polyclonal to Human TNK2 / ACK1
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$425 
LS-B12327-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human TNK2 / ACK1
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
ACK1 antibody LS-B12327 is an unconjugated rabbit polyclonal antibody to human ACK1 (TNK2 ). Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human TNK2 / ACK1
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 70-385 of human TNK2 (NP_001010938.1). TGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWE
Specificity
Human TNK2 / ACK1
Usage
The predicted MW is 60kDa/114kDa/119kDa, while the observed MW by Western blot was 110kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TNK2 / ACK1
Q07912 NM_005781 NP_005772.3

Validation

Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Validated
Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)

Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Validated
Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)

Publications (0)

Reviews (0)

Featured Products

Product
Species: Human
Applications: Western blot, ELISA
Dot blot of anti-Phospho-ACK1-pY518 Antibody on nitrocellulose membrane. 50ng of Phospho-peptide or Non Phospho-peptide per dot were adsorbed. Antibody working concentrations are 0.5ug per ml.
Species: Human
Applications: Dot Blot
Anti-TNK2 / ACK1 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 1.25 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Formalin-fixed and paraffin-embedded human cancer tissue reacted with the primary antibody, which was peroxidase-conjugated to the secondary antibody, followed by AEC staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated. BC = breast carcinoma; HC = hepatocarcinoma.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Immunohistochemical analysis of ACK1 (pY284) staining in human lung cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP-conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human, Mouse, Rat, Bovine, Pig
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
Reactivity: Human
Range: 0.05-12 ng/ml

Requested From: United States
Date Requested: 9/21/2019