Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

IHCPlus™ PLA2G2D Antibody Polyclonal IF,IHC,WB LS‑B15421

Catalog Number Size Price
LS-B15421-50 50 µl $425 
Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Immunohistochemistry of paraffin-embedded mouse testis tissue.
Immunohistochemistry of paraffin-embedded human liver cancer tissue.
Immunohistochemistry of paraffin-embedded human stomach tissue.
Western blot analysis of extracts of various cell lines.
Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Immunohistochemistry of paraffin-embedded mouse testis tissue.
Immunohistochemistry of paraffin-embedded human liver cancer tissue.
Immunohistochemistry of paraffin-embedded human stomach tissue.
Western blot analysis of extracts of various cell lines.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

IHCPlus™ PLA2G2D Antibody Polyclonal IF,IHC,WB LS‑B15421

Note: This antibody replaces LS-C334878
Antibody:
Rabbit Polyclonal to Human PLA2G2D
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$425 
LS-B15421-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human PLA2G2D
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
PLA2G2D antibody LS-B15421 is an unconjugated rabbit polyclonal antibody to PLA2G2D from human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human PLA2G2D
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:200)
  • Immunofluorescence (1:10 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 21-145 of human PLA2G2D (NP_036532.1). GILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
Specificity
Human PLA2G2D
Usage
The predicted MW is 16kDa, while the observed MW by Western blot was 20kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PLA2G2D
Q9UNK4 NM_012400 NP_036532.1

Validation

Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Validated
Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE)

Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Validated
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

Publications (0)

Reviews (0)

Featured Products

Western blot of recombinant PLA2G2D.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse
Applications: Western blot
PLA2G2D Antibody immunohistochemistry of formalin-fixed and paraffin-embedded human pancreas tissue followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
Western blot of recombinant PLA2G2D.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse
Applications: Western blot
Immunohistochemistry of paraffin-embedded human melanoma using PLA2G2D Antibody at dilution of 1:100
Species: Human
Applications: ELISA
Product
Species: Human
Applications: IHC, Western blot, Flow Cytometry, ELISA
Reactivity: Human
Range: 0.313-20 ng/ml

Requested From: United States
Date Requested: 9/18/2019