Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-B8072-50 50 µl (0.5 mg/ml) $460 
NFKB1 / NF-Kappa-B Antibody - Anti-NF-KappaB p105 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5-10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
NFKB1 / NF-Kappa-B Antibody - Fetal Thymus Lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
NFKB1 / NF-Kappa-B Antibody - Anti-NF-KappaB p105 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5-10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
NFKB1 / NF-Kappa-B Antibody - Fetal Thymus Lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
1 of 2
2 of 2

IHC‑plus™ Polyclonal Rabbit anti‑Human NFKB1 / NF‑Kappa‑B Antibody (N‑Terminus, IHC, WB) LS‑B8072

IHC‑plus™ Polyclonal Rabbit anti‑Human NFKB1 / NF‑Kappa‑B Antibody (N‑Terminus, IHC, WB) LS‑B8072

Note: This antibody replaces LS-C30205
NFKB1 / NF-Kappa-B Rabbit anti-Human Polyclonal (N-Terminus) Antibody
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Zebrafish
Unconjugated, Unmodified
Other formats:
Catalog Number
Toll Free North America
For Research Use Only


NFKB1 / NF-Kappa-B Rabbit anti-Human Polyclonal (N-Terminus) Antibody
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Zebrafish
Unconjugated, Unmodified
Other formats:


NF-Kappa-B antibody LS-B8072 is an unconjugated rabbit polyclonal antibody to NF-Kappa-B (NFKB1) (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Human NFKB1 / NF-Kappa-B
NFKB1 | Ebp- 1 | EBP-1 | NF-KappaB p50 | NFkappaB | NFKB-p50 | KBF1 | NF-kappa-B | NF-kappaB | NF-kB1 | NFKB-p105 | p105 | p50 | DNA binding factor KBF1 | DNA-binding factor KBF1 | NF-kappabeta
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Zebrafish (tested or 100% immunogen sequence identity)
IgG Polyclonal
Unconjugated. Also available conjugated with Biotin, FITC, HRP.
Affinity purified
Synthetic peptide from N-Terminus of human NFKB1 (P19838, NP_003989, aa 11-60) within the region PEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig (100%); Rabbit, Turkey, Zebra finch, Chicken (92%); Stickleback, Zebrafish (85%); Salmon (84%).
Human NFKB1
  • IHC
  • IHC - Paraffin (5 - 10 µg/ml)
  • Western blot (0.2 - 1 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
PBS, 0.09% sodium azide, 2% sucrose
Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NFKB1 / NF-Kappa-B
P19838 NM_003998 NP_003989.2


NFKB1 / NF-Kappa-B Antibody - Anti-NF-KappaB p105 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5-10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Anti-NF-KappaB p105 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5-10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Anti-NF-KappaB p105 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5-10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.

LSBio Ratings

IHC-plus™ NFKB1 / NF-Kappa-B Antibody (N-Terminus) for IHC, WB/Western LS-B8072 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 9/30/2022