Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13383-50 50 µl (1.02 mg/ml) $460 
KIAA0391 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
KIAA0391 Antibody - Western blot analysis of extracts of various cells.
KIAA0391 Antibody - Western blot analysis of extracts of various cell lines, using KIAA0391 antibody.
KIAA0391 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
KIAA0391 Antibody - Western blot analysis of extracts of various cells.
KIAA0391 Antibody - Western blot analysis of extracts of various cell lines, using KIAA0391 antibody.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Polyclonal Rabbit anti‑Human KIAA0391 Antibody (IHC, WB) LS‑B13383

IHC‑plus™ Polyclonal Rabbit anti‑Human KIAA0391 Antibody (IHC, WB) LS‑B13383

Note: This antibody replaces LS-C332515
Antibody:
KIAA0391 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13383-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
KIAA0391 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
KIAA0391 antibody LS-B13383 is an unconjugated rabbit polyclonal antibody to rat KIAA0391. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues. Cited in 1 publication.
Target
Human KIAA0391
Synonyms
KIAA0391 | MRPP3
Host
Rabbit
Reactivity
Human, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 314-583 of human KIAA0391 (NP_055487.2). YPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEEYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVAKMFPKVRESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPYDEDLVERCSCEVPTKWLCLHQKT
Specificity
Human KIAA0391
Applications
  • IHC
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 24kDa/56kDa/65kDa/67kDa, while the observed MW by Western blot was 70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About KIAA0391
O15091 AB002389 BAA20845.2

Validation

KIAA0391 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ KIAA0391 Antibody for IHC, WB/Western LS-B13383 has an LSBio Rating of
Publications (4)
Laboratory Validation Score (4)

Publications (1)

Mitochondrial unfolded protein response controls matrix pre-RNA processing and translation. Münch C, Harper JW. Nature. 2016 534:710-3. (WB; Human)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/30/2021