Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13393-50 50 µl $460 
GRN / Granulin Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
GRN / Granulin Antibody - Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
GRN / Granulin Antibody - Western blot analysis of extracts of various cell lines, using GRN antibody.
GRN / Granulin Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
GRN / Granulin Antibody - Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
GRN / Granulin Antibody - Western blot analysis of extracts of various cell lines, using GRN antibody.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Polyclonal Rabbit anti‑Human GRN / Granulin Antibody (IHC, WB) LS‑B13393

IHC‑plus™ Polyclonal Rabbit anti‑Human GRN / Granulin Antibody (IHC, WB) LS‑B13393

Note: This antibody replaces LS-C334281
Antibody:
GRN / Granulin Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13393-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
GRN / Granulin Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
Granulin antibody LS-B13393 is an unconjugated rabbit polyclonal antibody to Granulin (GRN) from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human GRN / Granulin
Synonyms
GRN | Acrogranin | CLN11 | Epithelin precursor | GEP | gp88 | Granulin | Granulin-epithelin | Granulins | PC cell-derived growth factor | PCDGF | PEPI | PGRN | Proepithelin | Progranulin
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-310 of human GRN (NP_002078.1). CPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFT
Specificity
Human GRN / Granulin.
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 44kDa/46kDa/63kDa, while the observed MW by Western blot was 50kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About GRN / Granulin
P28799 NM_002087 NP_002078.1

Validation

GRN / Granulin Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

GRN / Granulin Antibody - Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ GRN / Granulin Antibody for IHC, WB/Western LS-B13393 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/27/2021