Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B15344-50 50 µl (0.89 mg/ml) $425 
CXCR4 Antibody - Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
CXCR4 Antibody - Western blot analysis of extracts of various cell lines, using CXCR4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
CXCR4 Antibody - Western blot analysis of extracts of various cell lines.
CXCR4 Antibody - Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
CXCR4 Antibody - Western blot analysis of extracts of various cell lines, using CXCR4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
CXCR4 Antibody - Western blot analysis of extracts of various cell lines.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Monoclonal Rabbit anti‑Human CXCR4 Antibody (IHC, WB) LS‑B15344

IHC‑plus™ Monoclonal Rabbit anti‑Human CXCR4 Antibody (IHC, WB) LS‑B15344

Note: This antibody replaces LS-C331408
Antibody:
CXCR4 Rabbit anti-Human Monoclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$425
LS-B15344-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
CXCR4 Rabbit anti-Human Monoclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
CXCR4 antibody LS-B15344 is an unconjugated rabbit monoclonal antibody to CXCR4 from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human CXCR4
Synonyms
CXCR4 | CD184 | CD184 antigen | Cmkar4 | Cxc chemokine receptor 4 | CXCR-4 | CXC-R4 | D2S201E | FB22 | Fusin | HM89 | LCR1 | NPY3R | NPYRL | NPYY3R | Npyy3 | HSY3RR | SDF-1 receptor | WHIM | C-x-c chemokine receptor 4 | LESTR | Neuropeptide Y receptor Y3 | NPYR
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Monoclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CXCR4 (NP_003458.1). MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVA
Specificity
Human CXCR4
Applications
  • IHC
  • IHC - Paraffin (1:200)
  • Western blot (1:500 - 1:1000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 39kDa/40kDa, while the observed MW by Western blot was 36kDa/70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CXCR4
P61073 NM_003467 NP_003458.1

Validation

CXCR4 Antibody - Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ CXCR4 Antibody for IHC, WB/Western LS-B15344 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/28/2021