Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13394-50 50 µl (2.75 mg/ml) $460 
COMP / THBS5 Antibody - Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE)
COMP / THBS5 Antibody - Human Breast: Formalin-Fixed, Paraffin-Embedded (FFPE)
COMP / THBS5 Antibody - Western blot analysis of extracts of various cell lines.
COMP / THBS5 Antibody - Western blot analysis of extracts of various cell lines, using COMP antibody.
COMP / THBS5 Antibody - Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE)
COMP / THBS5 Antibody - Human Breast: Formalin-Fixed, Paraffin-Embedded (FFPE)
COMP / THBS5 Antibody - Western blot analysis of extracts of various cell lines.
COMP / THBS5 Antibody - Western blot analysis of extracts of various cell lines, using COMP antibody.
1 of 4
2 of 4
3 of 4
4 of 4

IHC‑plus™ Polyclonal Rabbit anti‑Human COMP / THBS5 Antibody (IHC, IF, WB) LS‑B13394

IHC‑plus™ Polyclonal Rabbit anti‑Human COMP / THBS5 Antibody (IHC, IF, WB) LS‑B13394

Note: This antibody replaces LS-C334311
Antibody:
COMP / THBS5 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13394-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
COMP / THBS5 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
THBS5 antibody LS-B13394 is an unconjugated rabbit polyclonal antibody to THBS5 (COMP) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human COMP / THBS5
Synonyms
COMP | MED | PSACH | Thrombospondin-5 | TSP5 | THBS5 | EDM1 | EPD1
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-160 of human COMP (NP_000086.2). GQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSG
Specificity
Human COMP / THBS5.
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:100)
  • Immunofluorescence (1:10 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 77kDa/82kDa, while the observed MW by Western blot was 110kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About COMP / THBS5
P49747 NM_000095 NP_000086.2

Validation

COMP / THBS5 Antibody - Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE)

COMP / THBS5 Antibody - Human Breast: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Breast: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Breast: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ COMP / THBS5 Antibody for IHC, IF/Immunofluorescence, WB/Western LS-B13394 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/5/2021