Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B15591-50 50 µl (5.68 mg/ml) $460 
ADAM8 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
ADAM8 Antibody - Western blot analysis of extracts of various cell lines, using ADAM8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
ADAM8 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
ADAM8 Antibody - Western blot analysis of extracts of various cell lines, using ADAM8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
1 of 2
2 of 2

IHC‑plus™ Polyclonal Rabbit anti‑Human ADAM8 Antibody (IHC, WB) LS‑B15591

IHC‑plus™ Polyclonal Rabbit anti‑Human ADAM8 Antibody (IHC, WB) LS‑B15591

Note: This antibody replaces LS-C497206
Antibody:
ADAM8 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B15591-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ADAM8 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
ADAM8 antibody LS-B15591 is an unconjugated rabbit polyclonal antibody to ADAM8 from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human ADAM8
Synonyms
ADAM8 | ADAM metallopeptidase domain 8 | Cell surface antigen MS2 | ADAM 8 | MS2 | CD156 | CD156a antigen
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 17-300 of human ADAM8 (NP_001100.3). IAPSRPWALMEQYEVVLPWRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAASLSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTT
Applications
  • IHC
  • IHC - Paraffin (1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 78kDa/80kDa/88kDa, while the observed MW by Western blot was 80kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ADAM8
P78325 NM_001109 NP_001100.3

Validation

ADAM8 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ ADAM8 Antibody for IHC, WB/Western LS-B15591 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/19/2024