Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13293-50 50 µl $460 
ACVR1C / ALK7 Antibody - Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
ACVR1C / ALK7 Antibody - Western blot analysis of extracts of SH-SY5Y cells, using ACVR1C antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
ACVR1C / ALK7 Antibody - Western blot analysis of 293T cell lysate using ACVR1C antibody.
ACVR1C / ALK7 Antibody - Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
ACVR1C / ALK7 Antibody - Western blot analysis of extracts of SH-SY5Y cells, using ACVR1C antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
ACVR1C / ALK7 Antibody - Western blot analysis of 293T cell lysate using ACVR1C antibody.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Polyclonal Rabbit anti‑Human ACVR1C / ALK7 Antibody (IHC, WB) LS‑B13293

IHC‑plus™ Polyclonal Rabbit anti‑Human ACVR1C / ALK7 Antibody (IHC, WB) LS‑B13293

Note: This antibody replaces LS-C335105
Antibody:
ACVR1C / ALK7 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13293-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
ACVR1C / ALK7 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
ALK7 antibody LS-B13293 is an unconjugated rabbit polyclonal antibody to ALK7 (ACVR1C) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human ACVR1C / ALK7
Synonyms
ACVR1C | Activin receptor-like kinase 7 | ACTR-IC | Activin receptor type IC | ACVRLK7 | Activin receptor type-1C | ALK7 | Activin A receptor, type IC | ALK-7
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 22-113 of human ACVR1C (NP_660302.2). LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
Specificity
Human ACVR1C / ALK7
Applications
  • IHC (1:100 - 1:200)
  • IHC - Paraffin (1:67)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 37kDa/46kDa/49kDa/54kDa, while the observed MW by Western blot was 60kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ACVR1C / ALK7
Q8NER5 NM_145259 NP_660302.2

Validation

ACVR1C / ALK7 Antibody - Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ ACVR1C / ALK7 Antibody for IHC, WB/Western LS-B13293 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/27/2021