Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
IGFBP3 Antibody LS‑C490381
IGFBP3 antibody LS-C490381 is an unconjugated rabbit polyclonal antibody to IGFBP3 from human and rat. Validated for ELISA, IHC and WB.
100 µg
IGFBP3 antibody LS-C490381 is an unconjugated rabbit polyclonal antibody to IGFBP3 from human and rat. Validated for ELISA, IHC and WB.
Human IGFBP3
Human, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
IGFBP3 antibody was raised against amino acids RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR of human IGFBP3 were used as the immunogen for the IGFBP3 antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Sterile distilled water
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About IGFBP3
P17936 NM_000598 NP_000589.2

Popular IGFBP3 Products

Antibody (0.02 ug/ml) staining of Human Breast cancer lysate (35 ug protein in RIPA buffer) with (B) and without (A) blocking with the immunizing peptide. Primary incubation was 1 hour. Detected by chemiluminescence.
Species: Human, Mouse, Rat, Bovine, Dog, Goat, Horse, Pig, Sheep
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay
IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
Species: Human, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
IGFBP3 / IGFBP-3 antibody. IHC(P): Human Breast Cancer Tissue.
Species: Human, Monkey, Bovine, Goat, Guinea pig, Horse, Pig, Sheep
Applications: IHC, IHC - Paraffin, Western blot
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
Formalin-fixed and paraffin-embedded human hepatocarcinoma tissue reacted with IGFBP3 Antibody , which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
Species: Rat, Human
Applications: IHC, IHC - Paraffin, Western blot

Publications (0)

Customer Reviews (0)


Immunohistochemistry - Paraffin

Western blot

Immunohistochemistry - Paraffin

Western blot

Immunohistochemistry - Paraffin

Western blot

Immunohistochemistry - Paraffin

Western blot

Requested From: United States
Date Requested: 11/19/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy