LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
IGFBP3 Antibody (aa214‑252) LS‑C407922
IGFBP3 antibody LS-C407922 is an unconjugated rabbit polyclonal antibody to IGFBP3 from human and rat. Validated for ELISA, IHC and WB. Cited in 1 publication.
Catalog
Size
Price
LS-C407922-100
100 µg
$355

Popular IGFBP3 Products

Antibody (0.02 ug/ml) staining of Human Breast cancer lysate (35 ug protein in RIPA buffer) with (B) and without (A) blocking with the immunizing peptide. Primary incubation was 1 hour. Detected by chemiluminescence.
Species: Human, Mouse, Rat, Bovine, Dog, Goat, Horse, Pig, Sheep
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Antibody
Species: Human
Applications: ELISA, Radioimmunoassay
IGFBP3 / IGFBP-3 antibody. IHC(P): Human Breast Cancer Tissue.
Species: Human, Monkey, Bovine, Goat, Guinea pig, Horse, Pig, Sheep
Applications: IHC, IHC - Paraffin, Western blot
Antibody
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot

Product Description

IGFBP3 antibody LS-C407922 is an unconjugated rabbit polyclonal antibody to IGFBP3 from human and rat. Validated for ELISA, IHC and WB. Cited in 1 publication.
About IGFBP3
IGFBP3 is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. P17936 NM_000598 NP_000589.2

IGFBP3 Antibody, Binding protein 29 Antibody, Binding protein 53 Antibody, BP-53 Antibody, IGF-binding protein 3 Antibody, IGFBP-3 Antibody, IBP-3 Antibody, IBP3 Antibody


Specifications

Target
Human IGFBP3
Host
Rabbit
Reactivity
Human, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
  • ELISA (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
IGFBP3 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
Epitope
aa214-252
Specificity
Expressed by most tissues. Present in plasma.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitution
Reconstitute with 200 µl of distilled water.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
Restrictions
For research use only.

Publications (1)

1
EZH1 and EZH2 promote skeletal growth by repressing inhibitors of chondrocyte proliferation and hypertrophy. Lui JC, Garrison P, Nguyen Q, Ad M, Keembiyehetty C, Chen W, Jee YH, Landman E, Nilsson O, Barnes KM, Baron J. Nature communications. 2016 7:13685. (WB; Human) [Full Text Article] [PubMed:27897169]

Customer Reviews (0)


Images

Immunohistochemistry

IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.

Western blot

IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.

Immunohistochemistry

IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.

Western blot

IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.

Immunohistochemistry

IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.

Western blot

IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.

Immunohistochemistry

IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.

Western blot

IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.

Requested From: United States
Date Requested: 9/19/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy