Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

IGFBP3 Antibody (aa214-252) LS-C407922

IGFBP3 antibody LS-C407922 is an unconjugated rabbit polyclonal antibody to IGFBP3 from human and rat. Validated for ELISA, IHC and WB. Cited in 1 publication.
100 µg
IGFBP3 antibody LS-C407922 is an unconjugated rabbit polyclonal antibody to IGFBP3 from human and rat. Validated for ELISA, IHC and WB. Cited in 1 publication.
Human IGFBP3
Human, Rat (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
  • ELISA (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
IGFBP3 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
Expressed by most tissues. Present in plasma.
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitute with 200 µl of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
About IGFBP3
P17936 NM_000598 NP_000589.2

Popular IGFBP3 Products

Antibody (0.02 ug/ml) staining of Human Breast cancer lysate (35 ug protein in RIPA buffer) with (B) and without (A) blocking with the immunizing peptide. Primary incubation was 1 hour. Detected by chemiluminescence.
Species: Human, Mouse, Rat, Bovine, Dog, Goat, Horse, Pig, Sheep
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Formalin-fixed and paraffin-embedded human hepatocarcinoma tissue reacted with IGFBP3 Antibody , which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
Species: Rat, Human
Applications: IHC, IHC - Paraffin, Western blot
IGFBP3 / IGFBP-3 antibody. IHC(P): Human Breast Cancer Tissue.
Species: Human, Monkey, Bovine, Goat, Guinea pig, Horse, Pig, Sheep
Applications: IHC, IHC - Paraffin, Western blot
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot

Publications (1)

EZH1 and EZH2 promote skeletal growth by repressing inhibitors of chondrocyte proliferation and hypertrophy. Lui JC, Garrison P, Nguyen Q, Ad M, Keembiyehetty C, Chen W, Jee YH, Landman E, Nilsson O, Barnes KM, Baron J. Nature communications. 2016 7:13685. (WB; Human) [Full Text Article] [PubMed:27897169]

Customer Reviews (0)



IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.

Western blot

IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.


IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.

Western blot

IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.


IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.

Western blot

IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.


IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.

Western blot

IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.

Requested From: United States
Date Requested: 2/22/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy