LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
IFNW1 Antibody LS‑C409661
IFNW1 antibody LS-C409661 is an unconjugated rabbit polyclonal antibody to IFNW1 from mouse and rat. Validated for IHC and WB.
Catalog
Size
Price
LS-C409661-50
50 µl
$255
LS-C409661-100
100 µl
$315
LS-C409661-200
200 µl
$425

Popular IFNW1 Products

Antibody
Species: Human, Mouse, Rat
Applications: Western blot
Western blot analysis of IFN omega expression in HEK293T (A); NIH3T3 (B); H9C2 (C) whole cell lysates.
Species: Human, Monkey, Mouse, Rat
Applications: Western blot
Antibody
Species: Human, Mouse, Rat
Applications: Western blot
Western blot analysis of lysate from HeLa cells, using IFNW1 Antibody.
Species: Human
Applications: Western blot, ELISA

Product Description

IFNW1 antibody LS-C409661 is an unconjugated rabbit polyclonal antibody to IFNW1 from mouse and rat. Validated for IHC and WB.

Specifications

Target
Human IFNW1
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
IFNW1 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 22-195 of human IFNW1 (NP_002168.1). LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
Specificity
Human IFNW1.
Usage
The predicted MW is 22kDa, while the observed MW by Western blot was 27kDa.
Presentation
PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat lung tissue.
Immunohistochemistry of paraffin-embedded rat lung tissue.

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat lung tissue.
Immunohistochemistry of paraffin-embedded rat lung tissue.

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat lung tissue.
Immunohistochemistry of paraffin-embedded rat lung tissue.

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat lung tissue.
Immunohistochemistry of paraffin-embedded rat lung tissue.

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Requested From: United States
Date Requested: 7/20/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number