LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
ICSBP / IRF8 Antibody LS‑C335605
IRF8 antibody LS-C335605 is an unconjugated rabbit polyclonal antibody to IRF8 (ICSBP) from human and mouse. Validated for IF, IHC and WB.
Catalog
Size
Price
LS-C335605-50
50 µl
$235
LS-C335605-100
100 µl
$315
LS-C335605-200
200 µl
$425

Popular ICSBP / IRF8 Products

Anti-IRF8 antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B2127 concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Anti-IRF8 antibody IHC of human small intestine, Peyer's patch. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B578 concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
IRF8 antibody LS-C29725 was used in IHC to stain formalin-fixed, paraffin-embedded human liver.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Chicken, Xenopus, Zebrafish
Applications: IHC, IHC - Paraffin, Western blot
Detection of Mouse IRF8 by Western Blot. Samples: Whole cell lysate from RAW 264.7 (66 and 33 ug ). Antibodies: Affinity purified rabbit anti-IRF8 antibody used for WB at 1.0 ug/ml. Detection: Chemiluminescence with exposure time of 30 seconds.
Species: Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Rabbit
Applications: Western blot, Immunoprecipitation
Western blot of anti-IRF8 Antibody in HL60 cell line lysates (35 ug/lane). IRF8 (arrow) was detected using the purified antibody.
Species: Human
Applications: Western blot, Flow Cytometry

Product Description

IRF8 antibody LS-C335605 is an unconjugated rabbit polyclonal antibody to IRF8 (ICSBP) from human and mouse. Validated for IF, IHC and WB.
About ICSBP / IRF8
Interferon consensus sequence-binding protein (ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. Q02556 NM_002163 NP_002154.1

IRF8 Antibody, H-ICSBP Antibody, Interferon regulatory factor 8 Antibody, ICSBP Antibody, ICSBP1 Antibody, IRF-8 Antibody


Specifications

Target
Human ICSBP / IRF8
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:10 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
ICSBP / IRF8 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 137-426 of human IRF8 (NP_002154.1). ECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV
Specificity
Human ICSBP / IRF8.
Usage
The predicted MW is 48kDa, while the observed MW by Western blot was 53kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.

Publications (0)


Customer Reviews (0)


Images

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 9/22/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy