Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > HSPA2 > LS-C407851
 
Print Page  
Catalog Number Size Price
LS-C407851-10 10 µg $318 
LS-C407851-100 100 µg $470 
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.
HSPA2 Antibody - IF analysis of HSPA2 using anti-HSPA2 antibody HSPA2 was detected in immunocytochemical section of PC-3 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSPA2 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSPA2 Antibody - IF analysis of HSPA2 using anti-HSPA2 antibody HSPA2 was detected in immunocytochemical section of PC-3 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSPA2 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSPA2 Antibody - HSPA2 antibody Western blot. All lanes: Anti HSPA2 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Rat Testis Tissue Lysate at 50 ug. Lane 4: Mouse Liver Tissue Lysate at 50 ug. Lane 5: Mouse Kidney Tissue Lysate at 50 ug. Lane 6: HELA Whole Cell Lysate at 40 ug. Lane 7: MCF-7 Whole Cell Lysate at 40 ug. Lane 8: A375 Whole Cell Lysate at 40 ug. Lane 9: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 70 kD. Observed band size: 70 kD.
HSPA2 Antibody - Flow Cytometry analysis of PC-3 cells using anti-HSPA2 antibody. Overlay histogram showing PC-3 cells stained with anti-HSPA2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-HSPA2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.
HSPA2 Antibody - IF analysis of HSPA2 using anti-HSPA2 antibody HSPA2 was detected in immunocytochemical section of PC-3 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSPA2 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSPA2 Antibody - IF analysis of HSPA2 using anti-HSPA2 antibody HSPA2 was detected in immunocytochemical section of PC-3 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSPA2 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSPA2 Antibody - HSPA2 antibody Western blot. All lanes: Anti HSPA2 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Rat Testis Tissue Lysate at 50 ug. Lane 4: Mouse Liver Tissue Lysate at 50 ug. Lane 5: Mouse Kidney Tissue Lysate at 50 ug. Lane 6: HELA Whole Cell Lysate at 40 ug. Lane 7: MCF-7 Whole Cell Lysate at 40 ug. Lane 8: A375 Whole Cell Lysate at 40 ug. Lane 9: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 70 kD. Observed band size: 70 kD.
HSPA2 Antibody - Flow Cytometry analysis of PC-3 cells using anti-HSPA2 antibody. Overlay histogram showing PC-3 cells stained with anti-HSPA2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-HSPA2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human HSPA2 Antibody (aa564‑598, IHC, WB) LS‑C407851

Polyclonal Rabbit anti‑Human HSPA2 Antibody (aa564‑598, IHC, WB) LS‑C407851

Submit Review LSBio Guarantee
Antibody:
HSPA2 Rabbit anti-Human Polyclonal (aa564-598) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Dog, Hamster, Pig
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407851-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
HSPA2 Rabbit anti-Human Polyclonal (aa564-598) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Dog, Hamster, Pig
Format:
Unconjugated, Unmodified

Specifications

Description
HSPA2 antibody LS-C407851 is an unconjugated rabbit polyclonal antibody to HSPA2 (aa564-598) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human HSPA2
Synonyms
HSPA2 | Heat shock 70kD protein 2 | HSP70-2 | HSP70-3 | Heat shock 70 kDa protein 2 | Heat shock 70kDa protein 2
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog, Hamster, Pig (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human HSPA2 (564-598 aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
Epitope
aa564-598
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HSPA2
P54652 NM_021979 NP_068814.2

Publications (0)

Submit a Publication for LS-C407851

Customer Reviews (0)

Submit a review for LS-C407851

Featured Products

HSPA2 Antibody - Western blot analysis of HSPA2 using anti-HSPA2 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: mouse spleen Tissue Lysate, Lane 2: mouse testis tissue Lysate, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HSPA2 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HSPA2 at approximately 70KD. The expected band size for HSPA2 is at 70KD.
HSPA2 Antibody (aa580‑599) LS‑C312957
Species: Human, Monkey, Mouse, Rat, Bovine, Goat, Pig, Sheep
Applications: Western blot
HSPA2 ELISA Kit
Human HSPA2 (Sandwich ELISA) ELISA Kit - LS-F35944
Reactivity: Human
Range: 0.78-50 ng/ml
HSPA2 Protein
Human HSPA2 Protein (Recombinant His, N-Terminal) (Ser2-Asp639) - LS-G97005
Source: E. coli
Tag: His, N-Terminal
SOCS2 Antibody - Immunohistochemistry of paraffin-embedded Human brain using SOCS2 Polyclonal Antibody at dilution of 1:40.
SOCS2 Antibody LS‑C404294
Species: Human, Mouse, Rat
Applications: IHC, ELISA
GABBR1 / GABA B Receptor 1 Antibody - Immunofluorescence of monoclonal antibody to GABBR1 on HeLa cell. [antibody concentration 10 ug/ml]
GABBR1 / GABA B Receptor 1 Antibody (clone 2D7) LS‑C197262
Species: Human
Applications: Immunofluorescence, Western blot, ELISA, RNA interference
Prothrombin Fragment 1+2 ELISA Kit
Human Prothrombin Fragment 1+2 (Sandwich ELISA) ELISA Kit - LS-F23736
Reactivity: Human
Range: 46.88-3000 pg/ml
See all HSPA2 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/24/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com