Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (800) 227-6666


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407851-10 10 µg $318 
LS-C407851-100 100 µg $470 
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.
HSPA2 Antibody - IF analysis of HSPA2 using anti-HSPA2 antibody HSPA2 was detected in immunocytochemical section of PC-3 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSPA2 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSPA2 Antibody - IF analysis of HSPA2 using anti-HSPA2 antibody HSPA2 was detected in immunocytochemical section of PC-3 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSPA2 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSPA2 Antibody - HSPA2 antibody Western blot. All lanes: Anti HSPA2 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Rat Testis Tissue Lysate at 50 ug. Lane 4: Mouse Liver Tissue Lysate at 50 ug. Lane 5: Mouse Kidney Tissue Lysate at 50 ug. Lane 6: HELA Whole Cell Lysate at 40 ug. Lane 7: MCF-7 Whole Cell Lysate at 40 ug. Lane 8: A375 Whole Cell Lysate at 40 ug. Lane 9: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 70 kD. Observed band size: 70 kD.
HSPA2 Antibody - Flow Cytometry analysis of PC-3 cells using anti-HSPA2 antibody. Overlay histogram showing PC-3 cells stained with anti-HSPA2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-HSPA2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
HSPA2 Antibody - HSPA2 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.
HSPA2 Antibody - IF analysis of HSPA2 using anti-HSPA2 antibody HSPA2 was detected in immunocytochemical section of PC-3 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSPA2 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSPA2 Antibody - IF analysis of HSPA2 using anti-HSPA2 antibody HSPA2 was detected in immunocytochemical section of PC-3 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSPA2 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSPA2 Antibody - HSPA2 antibody Western blot. All lanes: Anti HSPA2 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Rat Testis Tissue Lysate at 50 ug. Lane 4: Mouse Liver Tissue Lysate at 50 ug. Lane 5: Mouse Kidney Tissue Lysate at 50 ug. Lane 6: HELA Whole Cell Lysate at 40 ug. Lane 7: MCF-7 Whole Cell Lysate at 40 ug. Lane 8: A375 Whole Cell Lysate at 40 ug. Lane 9: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 70 kD. Observed band size: 70 kD.
HSPA2 Antibody - Flow Cytometry analysis of PC-3 cells using anti-HSPA2 antibody. Overlay histogram showing PC-3 cells stained with anti-HSPA2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-HSPA2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human HSPA2 Antibody (aa564‑598, IHC, WB) LS‑C407851

Polyclonal Rabbit anti‑Human HSPA2 Antibody (aa564‑598, IHC, WB) LS‑C407851

Antibody:
HSPA2 Rabbit anti-Human Polyclonal (aa564-598) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Dog, Hamster, Pig
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407851-10
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
HSPA2 Rabbit anti-Human Polyclonal (aa564-598) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Dog, Hamster, Pig
Format:
Unconjugated, Unmodified

Specifications

Description
HSPA2 antibody LS-C407851 is an unconjugated rabbit polyclonal antibody to HSPA2 (aa564-598) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human HSPA2
Synonyms
HSPA2 | Heat shock 70kD protein 2 | HSP70-2 | HSP70-3 | Heat shock 70 kDa protein 2 | Heat shock 70kDa protein 2
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog, Hamster, Pig (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human HSPA2 (564-598 aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
Epitope
aa564-598
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HSPA2
P54652 NM_021979 NP_068814.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/14/2024