Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C750507-20 20 µl $253 
LS-C750507-50 50 µl $279 
LS-C750507-100 100 µl $333 
LS-C750507-200 200 µl $429 
HOPX / HOP Antibody - Western blot analysis of extracts of various cell lines, using HOPX antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Polyclonal Rabbit anti‑Human HOPX / HOP Antibody (WB) LS‑C750507

Polyclonal Rabbit anti‑Human HOPX / HOP Antibody (WB) LS‑C750507

HOPX / HOP Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


HOPX / HOP Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


HOP antibody LS-C750507 is an unconjugated rabbit polyclonal antibody to HOP (HOPX) from human. It is reactive with human, mouse and rat. Validated for WB.
Human HOPX / HOP
HOPX | CAMEO | HOD | Homeodomain-only protein | HOP | HOP homeobox | LAGY | NECC1 | Odd homeobox protein 1 | OB1 | TOTO | Odd homeobox 1 protein | SMAP31
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human HOPX (NP_631957.1). MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
  • Western blot (1:200 - 1:2000)
The predicted MW is 8kDa/10kDa/12kDa, while the observed MW by Western blot was 13kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HOPX / HOP
Q9BPY8 NM_032495 BAB40926.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 5/11/2021