Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
HMGIY / HMGA1 Antibody LS‑C747780
HMGA1 antibody LS-C747780 is an unconjugated rabbit polyclonal antibody to HMGA1 (HMGIY) from human, mouse and rat. Validated for IHC and WB.
50 µl
HMGA1 antibody LS-C747780 is an unconjugated rabbit polyclonal antibody to HMGA1 (HMGIY) from human, mouse and rat. Validated for IHC and WB.
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:1000 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
HMGIY / HMGA1 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 (NP_665908.1). MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ
The predicted MW is 10kDa/11kDa/19kDa, while the observed MW by Western blot was 16kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.

Popular HMGIY / HMGA1 Products

Anti-HMGA1 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Human, Monkey, Mouse, Rat, Bat, Dog, Hamster, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Western blot
Anti-HMGA1 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 3.75 ug/ml.
Species: Human, Monkey, Mouse, Rat, Bat, Dog, Hamster, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Anti-HMGA1 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 4 ug/ml.
Species: Human, Monkey, Mouse, Rat, Bat, Dog, Hamster, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Peptide Enzyme-Linked Immunosorbent Assay
Fluorescent image of A549 cell stained with HMGA1 Antibody. A549 cells were fixed with 4% PFA (20 min), permeabilized with Triton X-100 (0.1%, 10 min), then incubated with HMGA1 primary antibody (1:25, 1 h at 37°C). For secondary antibody, Alexa Fluor 488 conjugated donkey anti-rabbit antibody (green) was used (1:400, 50 min at 37°C). Cytoplasmic actin was counterstained with Alexa Fluor 555 (red) conjugated Phalloidin (7units/ml, 1 h at 37°C). HMGA1 immunoreactivity is localized to Nucleus significantly.
Species: Human, Mouse, Rat
Applications: Immunofluorescence, Western blot, Flow Cytometry
Immunohistochemistry of paraffin-embedded human stomach using HMGA1 antibody at dilution of 1:100 (40x lens).
Species: Human
Applications: IHC, Immunofluorescence, Western blot

Publications (0)

Customer Reviews (0)



Immunohistochemistry of paraffin-embedded mouse kidney using HMGA1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse kidney using HMGA1 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded mouse brain using HMGA1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse brain using HMGA1 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using HMGA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using HMGA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.


Immunohistochemistry of paraffin-embedded mouse kidney using HMGA1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse kidney using HMGA1 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded mouse brain using HMGA1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse brain using HMGA1 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using HMGA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using HMGA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.


Immunohistochemistry of paraffin-embedded mouse kidney using HMGA1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse kidney using HMGA1 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded mouse brain using HMGA1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse brain using HMGA1 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using HMGA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using HMGA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.


Immunohistochemistry of paraffin-embedded mouse kidney using HMGA1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse kidney using HMGA1 antibody at dilution of 1:100 (40x lens).


Immunohistochemistry of paraffin-embedded mouse brain using HMGA1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse brain using HMGA1 antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using HMGA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using HMGA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Requested From: United States
Date Requested: 11/19/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy