Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C746786-20 20 µl $215 
LS-C746786-50 50 µl $235 
LS-C746786-100 100 µl $295 
LS-C746786-200 200 µl $385 
HMGIY / HMGA1 Antibody - Immunohistochemistry of paraffin-embedded human stomach using HMGA1 antibody at dilution of 1:100 (40x lens).
HMGIY / HMGA1 Antibody - Immunofluorescence analysis of HeLa cells using HMGA1 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
HMGIY / HMGA1 Antibody - Western blot analysis of extracts of 293T cells, using HMGA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
HMGIY / HMGA1 Antibody - Immunohistochemistry of paraffin-embedded human stomach using HMGA1 antibody at dilution of 1:100 (40x lens).
HMGIY / HMGA1 Antibody - Immunofluorescence analysis of HeLa cells using HMGA1 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
HMGIY / HMGA1 Antibody - Western blot analysis of extracts of 293T cells, using HMGA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
1 of 3
2 of 3
3 of 3

Polyclonal HMGIY / HMGA1 Antibody (IHC, IF, WB) LS‑C746786

Polyclonal HMGIY / HMGA1 Antibody (IHC, IF, WB) LS‑C746786

Antibody:
Rabbit Polyclonal to Human HMGIY / HMGA1
Application:
IHC, IF, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$215 
LS-C746786-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
Rabbit Polyclonal to Human HMGIY / HMGA1
Application:
IHC, IF, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
HMGA1 antibody LS-C746786 is an unconjugated rabbit polyclonal antibody to human HMGA1 (HMGIY). Validated for IF, IHC and WB.
Target
Human HMGIY / HMGA1
Synonyms
HMGA1 | High mobility group protein A1 | High mobility group protein R | HMG-R | Hmg-i | HMGIY | High mobility group AT-hook 1 | HMG-I(Y) | HMGA1A
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 (NP_665908.1). MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ
Usage
The predicted MW is 10kDa/11kDa/19kDa, while the observed MW by Western blot was 20kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HMGIY / HMGA1

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 3/30/2020