LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

IHC‑plus™ HLA‑DQA1 Antibody LS‑B14500

Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE)
Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cell lines, using HLA-DQA1 antibody.
Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE)
Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cell lines, using HLA-DQA1 antibody.
1 of 3
2 of 3
3 of 3

IHC‑plus™ HLA‑DQA1 Antibody LS‑B14500

Note: This antibody replaces LS-C331952
Antibody:
Rabbit Polyclonal to Human HLA-DQA1
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$425 
LS-B14500-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human HLA-DQA1
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
HLA-DQA1 antibody LS-B14500 is an unconjugated rabbit polyclonal antibody to HLA-DQA1 from human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human HLA-DQA1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
HLA-DQA1 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 24-216 of human HLA-DQA1 (NP_002113.2). EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELT
Specificity
Human HLA-DQA1
Usage
The predicted MW is 27kDa, while the observed MW by Western blot was 28kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HLA-DQA1
P01909 NM_002122 NP_002113.2

Validation

Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Validated
Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE)

Publications (0)

Reviews (0)

Featured Products

Reactivity: Monkey
Range: 0.4-70 ng/ml
Anti-SIGLEC15 / SIGLEC-15 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE).  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human, Monkey, Mouse, Rat, Bovine, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Anti-FPR1 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:200.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay

Requested From: United States
Date Requested: 7/21/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy